DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eq and Tspan4

DIOPT Version :9

Sequence 1:NP_523643.2 Gene:Tsp42Eq / 35628 FlyBaseID:FBgn0033138 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_030098725.1 Gene:Tspan4 / 64540 MGIID:1928097 Length:333 Species:Mus musculus


Alignment Length:243 Identity:50/243 - (20%)
Similarity:89/243 - (36%) Gaps:63/243 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FVLDFLCCVLAALTIAACSYALIAFS------------------------HSVAIRVPSI----L 49
            |:|:...|.:|...:....|.:.||:                        .:::...||:    |
Mouse    87 FLLELKRCSMARGCLQGVKYLMFAFNLLFWLGGCGVLGVGIWLAATQGNFATLSSSFPSLSAANL 151

  Fly    50 GIVLGGLLFFSTIFGCIAALRES--IRMTWIYAAILLALVFSQITVIL----------AQPINYE 102
            .||.|..:......|||.||:|:  :.:|:....:|:.|:.:.|.|:.          ||   .:
Mouse   152 LIVTGTFVMAIGFVGCIGALKENKCLLLTFFVLLLLVFLLEATIAVLFFAYSDKIDSYAQ---QD 213

  Fly   103 LLANETIYDAWQGQLYHSDRMSYFEIKYHCCGQTGPANYPD-----SGLVIPQSCYFNQNATVTT 162
            |.....:|.. ||.:..::..|..:..:.||   |.:||.|     :...:|.||...       
Mouse   214 LKKGLHLYGT-QGNVGLTNAWSIIQTDFRCC---GVSNYTDWFEVYNATRVPDSCCLE------- 267

  Fly   163 DLYTVGCNHQLAAAFVKGTRWEKITDWSVVGVEILTVIIAGLLAITLQ 210
              ::..|.......:.|...:|.:..|  :...:|.|.|.||....:|
Mouse   268 --FSDSCGLHEPGTWWKSPCYETVKAW--LQENLLAVGIFGLCTALVQ 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EqNP_523643.2 Tetraspannin 8..209 CDD:278750 49/240 (20%)
tetraspanin_LEL 95..173 CDD:239401 17/92 (18%)
Tspan4XP_030098725.1 Tetraspannin 104..321 CDD:366035 46/226 (20%)
NET-5_like_LEL 200..297 CDD:239418 20/114 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.