DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eq and tspan4b

DIOPT Version :9

Sequence 1:NP_523643.2 Gene:Tsp42Eq / 35628 FlyBaseID:FBgn0033138 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001076276.1 Gene:tspan4b / 556934 ZFINID:ZDB-GENE-070410-127 Length:232 Species:Danio rerio


Alignment Length:231 Identity:52/231 - (22%)
Similarity:98/231 - (42%) Gaps:43/231 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LCCVLAALTIAACSYAL-----------IAFSH----SVAIRVPSI----LGIVLGGLLFFSTIF 63
            ||||...:.:....:.|           :||:.    |:.:..||:    |.:|.||:...:...
Zfish     8 LCCVKYLMFVFNLIFWLGGCGLFGVGVWLAFTQSEFSSLPLSFPSLSAANLLLVAGGVTMVTGFL 72

  Fly    64 GCIAALRESIRMTWIYAAILLALVFSQITVILAQPINYELLANETIYDAWQGQLYHSD----RMS 124
            ||:.||:|...:...:..|||.||.:::.:||...:.:|.|..:...|..:|...:|.    |.|
Zfish    73 GCLGALKEQKCLLLTFFVILLILVLTEVVLILVLSLYHEELDKKAKDDLREGMKGYSKNDGLRKS 137

  Fly   125 Y--FEIKYHCCGQTGPANYPDSGL--VIPQSCYFNQNATVTTDLYTVGCNHQLAAAFVKGTRWEK 185
            :  .::.:.|||.:...::.:...  .:|.||..|..::         |.|.....:.|..:|..
Zfish   138 WDNMQMIFKCCGVSNHTDWHNKTTDGKLPGSCCSNDPSS---------CRHWEEPCYEKAKQWLL 193

  Fly   186 ITDWSVVG-------VEILTVIIAGLLAITLQNAER 214
            ....||:|       |::|.::.:.|:...:..||:
Zfish   194 TNITSVLGFGVCIGIVQLLALVFSMLMYCQILRAEK 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EqNP_523643.2 Tetraspannin 8..209 CDD:278750 50/224 (22%)
tetraspanin_LEL 95..173 CDD:239401 17/85 (20%)
tspan4bNP_001076276.1 Tetraspannin 10..224 CDD:278750 48/222 (22%)
NET-5_like_LEL 108..196 CDD:239418 18/96 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.