DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eq and Tsp97E

DIOPT Version :9

Sequence 1:NP_523643.2 Gene:Tsp42Eq / 35628 FlyBaseID:FBgn0033138 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001263002.1 Gene:Tsp97E / 43241 FlyBaseID:FBgn0039465 Length:228 Species:Drosophila melanogaster


Alignment Length:166 Identity:41/166 - (24%)
Similarity:64/166 - (38%) Gaps:28/166 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SCGTKALKVSSFVLDFLCCVLAALTIAACSYALIAFSHSVAIRVPSILGIV-LGGLLFFSTIFGC 65
            :|...||    ..|:.|..::..|.|....||..|   |:...:|.:.||: .|.:|...::.|.
  Fly     6 TCSKNAL----IALNILYVMIGFLLIGVGVYARAA---SIVTNLPIVGGILACGVILICISMLGL 63

  Fly    66 IAALRESIRMTWIYAAILLALVFSQITV---ILAQPINYELLANETIYDAWQGQL-YHSDRMSYF 126
            ..|::....|.:.|..||..|...|.::   .||  :|.|    :....|.||.: ..:|.....
  Fly    64 AGAVKHHQVMLFFYMIILFMLFLIQFSIASSCLA--VNSE----QQQQFAEQGWMTVPTDLRKQV 122

  Fly   127 EIKYHCCGQTG----------PANYPDSGLVIPQSC 152
            :....|||...          |:|.|...|:..|.|
  Fly   123 QDSLKCCGFNATAPSTTSVVPPSNEPSCELINQQCC 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EqNP_523643.2 Tetraspannin 8..209 CDD:278750 39/160 (24%)
tetraspanin_LEL 95..173 CDD:239401 17/69 (25%)
Tsp97ENP_001263002.1 Tetraspannin 7..204 CDD:278750 41/165 (25%)
tetraspanin_LEL <121..177 CDD:243179 9/38 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.