DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eq and Tsp96F

DIOPT Version :9

Sequence 1:NP_523643.2 Gene:Tsp42Eq / 35628 FlyBaseID:FBgn0033138 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001262976.1 Gene:Tsp96F / 43127 FlyBaseID:FBgn0027865 Length:284 Species:Drosophila melanogaster


Alignment Length:254 Identity:52/254 - (20%)
Similarity:92/254 - (36%) Gaps:65/254 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LAALTIAACSYALIA-----------FSH-SVAIRVPSILGIVLGGLLFFSTIFGCIAALRESIR 74
            |..|||...|..::.           ::| .:|:.|...:||    |:.....|||....|||..
  Fly    23 LIGLTIVVTSVWMLTDPTFMLSMTQNYNHYHIALYVFLAIGI----LITLGAFFGCCGVCRESQC 83

  Fly    75 MTWIYAAILLALVFSQITVILAQPINYELL-------ANETIYDAWQGQLYHSDRMSYFEI---K 129
            :...:..::|.::.:||........|.:.|       ...::.:.: ||...|.|...|:.   .
  Fly    84 LLVSFFCVILIVMVAQIAAGAWAFHNKDKLDDIVRAAVKSSVQEEY-GQSTMSSRTVTFDTLQKN 147

  Fly   130 YHCCGQTGPANYPDS--------GLV------------IPQSCYFNQ--------------NATV 160
            ..|||..||.::..|        .:|            ||:||..:.              ...:
  Fly   148 LKCCGADGPGDWATSRFNNVDRTNIVEIAVSSMNVFYNIPESCCKDNLKDNECELSRRLKFGGPL 212

  Fly   161 TTDLYTVGCNHQLAAAFVKGTRWEKITDWSVVGVEILTVIIAGLLAITLQNAERRRLYR 219
            ...:|..||..:|.....:  .|  :|.::|....||..:::...|::|..|.|.:.|:
  Fly   213 NNAIYQQGCVDKLIEIIYE--NW--VTIFAVTAAVILLELLSLTFALSLCCAVRNQHYK 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EqNP_523643.2 Tetraspannin 8..209 CDD:278750 48/242 (20%)
tetraspanin_LEL 95..173 CDD:239401 21/121 (17%)
Tsp96FNP_001262976.1 Tetraspannin 9..261 CDD:278750 49/246 (20%)
CD151_like_LEL 107..233 CDD:239408 22/128 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.