DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eq and Tsp86D

DIOPT Version :9

Sequence 1:NP_523643.2 Gene:Tsp42Eq / 35628 FlyBaseID:FBgn0033138 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001262468.1 Gene:Tsp86D / 41310 FlyBaseID:FBgn0037848 Length:316 Species:Drosophila melanogaster


Alignment Length:250 Identity:58/250 - (23%)
Similarity:111/250 - (44%) Gaps:53/250 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SCGTKALKVSSFVLDFLCCVLAALTIAACSYALI--AFSHSVAIRVPSI--------LGIVLGGL 56
            ||    :|...|:|:||..:...|.:|...||.:  ....:..:|:.:|        |.:::.|:
  Fly    29 SC----VKYMIFLLNFLFWLFGGLLLAIGVYAFMDKLMDGNGWLRLDTIYDVIFNISLVMIIAGV 89

  Fly    57 LFFSTIF-GCIAALRESIRMTWIYAAILLALVFSQITVILAQPINYELLANETIYDAWQGQLYHS 120
            :.|:..| ||:.||||:..:..:|:..||.....::::.:...: :....|..:...:..::.||
  Fly    90 IVFTVSFAGCLGALRENTWLLKLYSMCLLLFFILEMSLAIICFV-FPQYMNSFLEYQFTDKIIHS 153

  Fly   121 DR--------MSYFEIKYHCCGQTGPANYPD----------SGLV----IPQSCYFNQNAT-VTT 162
            .|        :.:.:.:::|||.:. |.|.|          |..|    :|.||..  ||| :::
  Fly   154 YRDDSDLQNFIDFAQQEFNCCGLSN-AGYQDWSKNEYFNCSSPSVERCGVPYSCCI--NATDISS 215

  Fly   163 DLYTVGCNHQLAAAFVKGTRWEKITDWSVVGVEILTV-------IIAGL-LAITL 209
            .|..:.|.:.:....|.... ::|  |:...:||:.|       :|||: |.|.|
  Fly   216 GLVNIMCGYGVQVRSVAAAS-KRI--WTSGCIEIVRVWVERNLYVIAGVALGIAL 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EqNP_523643.2 Tetraspannin 8..209 CDD:278750 55/242 (23%)
tetraspanin_LEL 95..173 CDD:239401 20/100 (20%)
Tsp86DNP_001262468.1 Tetraspannin 51..283 CDD:278750 49/223 (22%)
penumbra_like_LEL 132..255 CDD:239411 26/129 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.