DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eq and Tsp74F

DIOPT Version :9

Sequence 1:NP_523643.2 Gene:Tsp42Eq / 35628 FlyBaseID:FBgn0033138 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster


Alignment Length:257 Identity:54/257 - (21%)
Similarity:97/257 - (37%) Gaps:89/257 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSCGTKALKVSSFVLDFLCCVLAALTIAACSYALIAFSHSVAIRVPSILG-----------IVLG 54
            |.|..:.:|.|.|:.:|:..|..|:......:.|:..|.     |..:||           :|..
  Fly     7 MDCCGQFVKYSLFIANFVIFVGGAIVFCLTLWTLVDRSF-----VNELLGTNLFSGAVYVLLVTS 66

  Fly    55 GLLFFSTIFGCIAALRESIRMTWIYAAILLALVFSQITVILAQPINYELLANETIYDAWQGQ--- 116
            .::...:..||:.|.:| ::...:...|::||||  :|:::...:.|  :..|.:....:.:   
  Fly    67 IIICLVSFLGCVGAGKE-VKCLLLTYFIIVALVF--VTMLIGGVLGY--VFRERVQQTMRQEMRS 126

  Fly   117 ---LYHSDRMSYFEI---------KYHCCG--------QTGPANYPDSGLVIPQSC----YFNQN 157
               ||.|.|    ||         :..|||        :.||         :|:||    :..|.
  Fly   127 TMALYGSRR----EITQAWDLTQERLQCCGVDTWHDWNRYGP---------VPESCCQELFGGQR 178

  Fly   158 ATVT-----TDLYTVGC---------NHQLAAAFVKGTRWEKITDWSVVGVEILTVIIAGLL 205
            ...|     |:||..||         :|   ||.:.||           .:.:..::|.|::
  Fly   179 KECTIFPTITNLYNQGCLYVTTNFIRDH---AAVIGGT-----------SIAVAILMIFGMI 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EqNP_523643.2 Tetraspannin 8..209 CDD:278750 52/250 (21%)
tetraspanin_LEL 95..173 CDD:239401 24/118 (20%)
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 52/250 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.