DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eq and Tsp66E

DIOPT Version :9

Sequence 1:NP_523643.2 Gene:Tsp42Eq / 35628 FlyBaseID:FBgn0033138 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_523985.1 Gene:Tsp66E / 39017 FlyBaseID:FBgn0035936 Length:267 Species:Drosophila melanogaster


Alignment Length:260 Identity:55/260 - (21%)
Similarity:97/260 - (37%) Gaps:69/260 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CGTKALKVSSFVLDFLCCVL------AALTIAACSYALIA------------FSHSVAIRVPSIL 49
            ||....|....:.:|:..||      ..|.:|...::|||            |:...||...:.:
  Fly     5 CGVWCAKYLLCIFNFIFFVLGTIIFGVGLWLAVDKHSLIALLKLVESERIEQFTQPQAIEQLAYV 69

  Fly    50 GIVLGGLLFFSTIFGCIAALRESIRMTWIYAAILLALVFSQITV----------ILAQPINYELL 104
            .:|:|.::||.:..|.:.|:|||..:...|...|:.|:.::|..          :.|:..|: |.
  Fly    70 LLVIGAVMFFMSFLGYLGAMRESRCLLSTYGTFLILLLIAEIVAGGLGAFFKDKVRAESKNF-LQ 133

  Fly   105 ANETIYDAWQGQLYHSDRMSYFEI--KYHCCG-------QTGPANYPDSG-LVIPQSCYF----- 154
            ...|.|..  |:...:..:.:.::  .:.|||       ...||.....| ..||.:|..     
  Fly   134 TTITSYSL--GENVDATSLMWNQLMGNFGCCGINDYHDFDASPAWVNGKGNRTIPDACCILKDVA 196

  Fly   155 ---------NQNATVTTDLYTVGCNHQLAAAFVKGTRWEKITDWSVVGVEILTVIIA-GLLAITL 209
                     ..|.:.:...|..||             :|..|:|.:...|::.|.|| |::.:.|
  Fly   197 KLVPRDEDCTTNPSDSNSFYKKGC-------------YEVFTEWLIRQRELVIVAIAVGIVHLVL 248

  Fly   210  209
              Fly   249  248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EqNP_523643.2 Tetraspannin 8..209 CDD:278750 52/253 (21%)
tetraspanin_LEL 95..173 CDD:239401 19/101 (19%)
Tsp66ENP_523985.1 Tetraspannin 9..258 CDD:278750 53/256 (21%)
uroplakin_I_like_LEL 116..231 CDD:239409 22/130 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.