DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eq and CD82

DIOPT Version :9

Sequence 1:NP_523643.2 Gene:Tsp42Eq / 35628 FlyBaseID:FBgn0033138 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_002222.1 Gene:CD82 / 3732 HGNCID:6210 Length:267 Species:Homo sapiens


Alignment Length:271 Identity:52/271 - (19%)
Similarity:96/271 - (35%) Gaps:89/271 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GTKALKVSS---FVLDFLCCVLAALTIA--------ACSYALIAFSHSVAIRVPSILGIVLGGLL 57
            |:..:||:.   |:.:.:..:|.|:.:.        ..|:..:..:.|.::|:.:.:.|.:|.:.
Human     2 GSACIKVTKYFLFLFNLIFFILGAVILGFGVWILADKSSFISVLQTSSSSLRMGAYVFIGVGAVT 66

  Fly    58 FFSTIFGCIAALRESIRMTWIYAAILLALVFSQITV-----------------ILAQPI-NYELL 104
            ......|||.|:.|...:..:|.|.||.::.:|:|.                 |:.:.| :|...
Human    67 MLMGFLGCIGAVNEVRCLLGLYFAFLLLILIAQVTAGALFYFNMGKLKQEMGGIVTELIRDYNSS 131

  Fly   105 ANETIYDAWQGQLYHSDRMSYFEIKYHCCGQTGPANYPDSG-------LVIPQSCYF-------- 154
            ..:::.|||          .|.:.:..|||.....|:.|:.       :..|.||..        
Human   132 REDSLQDAW----------DYVQAQVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSL 186

  Fly   155 -------------NQNATVTTD--LYTVGCNHQLAAAFVKGTRWEKITDW------SVVGVEILT 198
                         .|:.....|  :|..||             .||:..|      .::||.:..
Human   187 SVRKGFCEAPGNRTQSGNHPEDWPVYQEGC-------------MEKVQAWLQENLGIILGVGVGV 238

  Fly   199 VIIAGLLAITL 209
            .||. ||.:.|
Human   239 AIIE-LLGMVL 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EqNP_523643.2 Tetraspannin 8..209 CDD:278750 50/265 (19%)
tetraspanin_LEL 95..173 CDD:239401 19/108 (18%)
CD82NP_002222.1 Tetraspannin 24..256 CDD:278750 47/249 (19%)
CD37_CD82_like_LEL 106..229 CDD:239413 23/145 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.