DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eq and Tsp42Ep

DIOPT Version :9

Sequence 1:NP_523643.2 Gene:Tsp42Eq / 35628 FlyBaseID:FBgn0033138 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001260759.1 Gene:Tsp42Ep / 35626 FlyBaseID:FBgn0033137 Length:250 Species:Drosophila melanogaster


Alignment Length:186 Identity:51/186 - (27%)
Similarity:85/186 - (45%) Gaps:24/186 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 ILGIVLGGLLFFSTIFGCIAALRESIRMTWIYAA-ILLALVFSQITVILAQPINYELLANETIYD 111
            :..:||||.:....:|||...:...:.:..|:.. ||:||....:     |..:|...:..:...
  Fly    48 VKSLVLGGSICMIVMFGCYGMVANLLCVNLIFTMFILIALAAEYL-----QLHHYHSPSLRSPGG 107

  Fly   112 AWQGQL---YHS-DR----MSYFEIKYHCCGQTGPANYPDSGLVIPQSCYFNQNATVTTDLYTVG 168
            ||| ||   :|. ||    |..:|...||||..|..:|....|::|.|||..........:|..|
  Fly   108 AWQ-QLELAWHGLDRDPELMHQYEASQHCCGYNGADDYKRLHLLVPASCYQAAVNDTAQQIYPSG 171

  Fly   169 CNHQLAAAFVKGTRW----EKITDWSVVGVEILTVIIAGLLAITL-QNAERRRLYR 219
            |...|.    :..|:    :|:..|::||:||..::....|::.| :..:|:|:.|
  Fly   172 CLETLN----RSQRYIQHRDKLYMWAIVGLEIFILLQTVALSVLLFRLRQRQRIAR 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EqNP_523643.2 Tetraspannin 8..209 CDD:278750 47/173 (27%)
tetraspanin_LEL 95..173 CDD:239401 26/85 (31%)
Tsp42EpNP_001260759.1 Tetraspannin <51..213 CDD:278750 47/171 (27%)
tetraspanin_LEL 91..183 CDD:239401 28/101 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.