DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eq and Tsp42Eo

DIOPT Version :9

Sequence 1:NP_523643.2 Gene:Tsp42Eq / 35628 FlyBaseID:FBgn0033138 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_523641.2 Gene:Tsp42Eo / 35625 FlyBaseID:FBgn0033136 Length:219 Species:Drosophila melanogaster


Alignment Length:212 Identity:56/212 - (26%)
Similarity:98/212 - (46%) Gaps:1/212 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LKVSSFVLDFLCCVLAALTIAACSYALIAFSHSVAIRVPSILGIVLGGLLFFSTIFGCIAALRES 72
            |:.:|.|...|..::..|...|..|.|..|:...|......:.:.:.|.|..:.:.||:.|:..|
  Fly     8 LQWTSVVFSTLTLIVGVLAALAGVYELDKFNEGSAEHTEKFVQLGMAGALILAGLVGCLGAIFGS 72

  Fly    73 IRMTWIYAAILLALVFSQITVILAQPINYELLANET-IYDAWQGQLYHSDRMSYFEIKYHCCGQT 136
            |::..:...:||||:.|.|..:.......:|.|.|. :.|.|..:|.|...|...:.:|.|||..
  Fly    73 IKVMVVNLILLLALIASHIWKVSHYNETKQLDATEVYVMDLWMKELVHHGAMQDLQQEYECCGDK 137

  Fly   137 GPANYPDSGLVIPQSCYFNQNATVTTDLYTVGCNHQLAAAFVKGTRWEKITDWSVVGVEILTVII 201
            |.::|....:.:|:||:..::.......|..||...:..|:::..|:||.....::|.|::.:|:
  Fly   138 GFSDYTSLNMKVPRSCFHTKDGIHALYPYGEGCMAAVKRAYLQIYRYEKWVHCGLIGYEVVGIIL 202

  Fly   202 AGLLAITLQNAERRRLY 218
            ...|...|.|..||..|
  Fly   203 GITLCCQLTNKTRRYTY 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EqNP_523643.2 Tetraspannin 8..209 CDD:278750 51/201 (25%)
tetraspanin_LEL 95..173 CDD:239401 20/78 (26%)
Tsp42EoNP_523641.2 Tetraspannin 7..210 CDD:278750 51/201 (25%)
tetraspanin_LEL 110..178 CDD:239401 17/67 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456995
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.