DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eq and Tsp42Ec

DIOPT Version :9

Sequence 1:NP_523643.2 Gene:Tsp42Eq / 35628 FlyBaseID:FBgn0033138 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_523629.1 Gene:Tsp42Ec / 35612 FlyBaseID:FBgn0033124 Length:232 Species:Drosophila melanogaster


Alignment Length:218 Identity:61/218 - (27%)
Similarity:100/218 - (45%) Gaps:25/218 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VLDFLCCVLAALTIAACSYALIAFSHSVAIRVPSILGIVLGGLLFFSTIFGCIAALRESIRMTWI 78
            ::..|..||.::.::..|...:|.|.:....:| |...|||||:|..:.|||....|:|:.||..
  Fly    21 IVGILLIVLGSIMLSDLSRFDVAGSGTDPNTIP-ICVTVLGGLIFVVSFFGCYGIFRQSVCMTGA 84

  Fly    79 YAAILLALVFSQITVILAQPINYELLANE---TIYDAWQGQLYHSDRMSYFEIKYHCCGQTGPAN 140
            |.:::..|...|:.:.....:|......:   .:...|....|.:  |...|..:.|||.|...|
  Fly    85 YTSMVFVLFILQLVLTCWVFVNRSAFLGDMSNLVNLLWDSHDYTA--MGVLEETFGCCGDTSYTN 147

  Fly   141 YPDSGLVIPQSC--YFNQNATVTT-DLY--TVGCNHQLAAAFVKGTRWEKITD---WSVVGV--- 194
            |.:.||.:|.:|  |.::.||..| .:|  ..||    :|.|.:  .|....|   ||.:|:   
  Fly   148 YNNIGLSVPGTCCGYLDRQATCNTPSVYQSRPGC----SAKFEE--FWNDNMDIIRWSGLGLCIF 206

  Fly   195 EILTVIIAGLL--AITLQNAERR 215
            :::..:|||.|  .:..|||.|:
  Fly   207 DLVVFLIAGALTNCMRSQNAGRQ 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EqNP_523643.2 Tetraspannin 8..209 CDD:278750 57/210 (27%)
tetraspanin_LEL 95..173 CDD:239401 22/85 (26%)
Tsp42EcNP_523629.1 Tetraspannin 7..221 CDD:278750 57/208 (27%)
tetraspanin_LEL 104..193 CDD:239401 25/96 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.