DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eq and Tsp29Fa

DIOPT Version :9

Sequence 1:NP_523643.2 Gene:Tsp42Eq / 35628 FlyBaseID:FBgn0033138 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001162915.1 Gene:Tsp29Fa / 34211 FlyBaseID:FBgn0032074 Length:248 Species:Drosophila melanogaster


Alignment Length:203 Identity:47/203 - (23%)
Similarity:78/203 - (38%) Gaps:54/203 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ALKVSSFVLDFLCCVLAALTIAA--------CSYALIAFSHSVAIRVPSILGIVLGGLLFFSTIF 63
            |:|.:.|..:.:..:...:.||.        ..|.|  |.......:|:.| ||:|..:...:.|
  Fly    10 AVKYTLFGFNLIFLITGIILIAVGAGVGAVYTGYKL--FLAGKFFSIPTFL-IVIGSFIIIISFF 71

  Fly    64 GCIAALRESIRMTWIYAAILLALVFSQITVILAQPINYELLANETIYDAWQGQLYHS-------- 120
            ||..||:|:..:...: :::||::|   .:.||..|:..:|.|:. .|..:..|.:|        
  Fly    72 GCWGALKENYCLVLSF-SVMLAIIF---ILELAAGISGYVLRNDA-SDLIKTSLTYSLNEYNSIN 131

  Fly   121 ---------DRMSYFEIKYHCCGQTGPAN----YPDSGLVIPQSC-----------YFNQNATVT 161
                     |....||    |||.|...:    :|:..|  |.||           ..|...:..
  Fly   132 PNATTKLWDDIQDEFE----CCGVTSYNDWITAFPNGDL--PISCCNVHVGAVGTFTCNNAQSSV 190

  Fly   162 TDLYTVGC 169
            .|.:.|||
  Fly   191 ADRHKVGC 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EqNP_523643.2 Tetraspannin 8..209 CDD:278750 46/202 (23%)
tetraspanin_LEL 95..173 CDD:239401 25/107 (23%)
Tsp29FaNP_001162915.1 Tetraspannin 11..238 CDD:278750 46/202 (23%)
tetraspanin_LEL 106..210 CDD:239401 22/100 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.