DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eq and cd82a

DIOPT Version :9

Sequence 1:NP_523643.2 Gene:Tsp42Eq / 35628 FlyBaseID:FBgn0033138 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_997826.2 Gene:cd82a / 324098 ZFINID:ZDB-GENE-030131-2818 Length:256 Species:Danio rerio


Alignment Length:248 Identity:52/248 - (20%)
Similarity:90/248 - (36%) Gaps:68/248 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ALKVSSFVLDFLCCVLAA------LTIAACSYALIAF--SHSVAIRVPSILGIVLGGLLFFSTIF 63
            |.|...|:.:|:..:..|      |.|...:.:|||.  ..||.::|.|.:.|.:|.........
Zfish     8 ATKYFLFLFNFIFFIFGATIMGFGLWILLDNQSLIAVLQESSVILKVVSYILIGVGSFSMLLGFL 72

  Fly    64 GCIAALRESIRMTWIYAAILLALVFSQITVIL------------AQPINYELLA-----NETIYD 111
            ||:.|:.|...:..:|...||.::.:|:.|.:            |..|..:::|     |:|...
Zfish    73 GCLGAIYEIRCLLGLYFTCLLLILLAQVAVSILIYFQRDLLKTEADKIVSQVVANYPGQNKTAEQ 137

  Fly   112 AWQGQLYHSDRMSYFEIKYHCCGQTGPANYPDSGLV-------IPQSCY-FNQNATVTTD----- 163
            ||          .|.:....|||..|..::.::.::       .|.||: ::..|.:..|     
Zfish   138 AW----------DYLQRTMQCCGWNGRMDWDENHIIKNNTVPLYPCSCHNYSIQAPIVPDNGFCQ 192

  Fly   164 -------LYTVGCNHQLAAAFVKGTRWEKITDWSVVGVEILTVIIAGLLAITL 209
                   :|..||             .|.:..|......|:..|..|:..|.|
Zfish   193 ASSSDWPIYQTGC-------------LEHVGSWLFTNYGIILGICLGVAVIEL 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EqNP_523643.2 Tetraspannin 8..209 CDD:278750 50/245 (20%)
tetraspanin_LEL 95..173 CDD:239401 20/114 (18%)
cd82aNP_997826.2 CD37_CD82_like_LEL 106..218 CDD:239413 22/134 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.