DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eq and Tsp5D

DIOPT Version :9

Sequence 1:NP_523643.2 Gene:Tsp42Eq / 35628 FlyBaseID:FBgn0033138 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001259266.1 Gene:Tsp5D / 31540 FlyBaseID:FBgn0029837 Length:287 Species:Drosophila melanogaster


Alignment Length:253 Identity:52/253 - (20%)
Similarity:86/253 - (33%) Gaps:63/253 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 CCVLAA---LTIAACSYALIAFSHSVAIRVPSILGIVLGGLLFFSTIFGCIAALRESIRMTWIYA 80
            |..|.|   |.::...||.:...|:........:||  ||..|..:.|||..|        |:.:
  Fly    25 CAFLGAGLWLRLSYAGYATLLPQHAGLSADTIFMGI--GGTGFVVSFFGCCGA--------WVQS 79

  Fly    81 AILLALVFSQITVI-----LAQPINY-------ELLANETIYDAWQGQLYHSDRMSY-------- 125
            ..||.|.|..|.::     |...|.:       ..||||..:.. :.....|||.|.        
  Fly    80 RCLLVLYFMLIVMLFMSEFLVGSIAFLFRGGLGRTLANELRFGI-ERHYNSSDRGSLVAPSVASI 143

  Fly   126 ---FEIKYHCCGQTGPANYPD-----SGLVIPQSC---YFNQNATVTTD---------------- 163
               .:..:.|||.:...::.|     ....:|:||   .::|...:|..                
  Fly   144 WDSVQQSFECCGVSSYEDWYDIQSWPGRRWVPESCCRTLYDQRQVLTEGSGDGMMRPDCGRSENP 208

  Fly   164 --LYTVGCNHQLAAAFVKGTRWEKITDWSVVGVEILTVIIAGLLAITLQNAERRRLYR 219
              .:..||.|.|.:.|.............:..|::..:|.:.||..|:::......|:
  Fly   209 SLWWDKGCAHSLQSWFTGQLNVVGAVGLGIAFVQLFGLITSMLLFCTVKHKRASDTYK 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EqNP_523643.2 Tetraspannin 8..209 CDD:278750 50/241 (21%)
tetraspanin_LEL 95..173 CDD:239401 22/121 (18%)
Tsp5DNP_001259266.1 Tetraspannin 8..256 CDD:278750 50/241 (21%)
NET-5_like_LEL 105..228 CDD:239418 22/123 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.