DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eq and Tspan9

DIOPT Version :9

Sequence 1:NP_523643.2 Gene:Tsp42Eq / 35628 FlyBaseID:FBgn0033138 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001101360.1 Gene:Tspan9 / 312728 RGDID:1304740 Length:330 Species:Rattus norvegicus


Alignment Length:248 Identity:49/248 - (19%)
Similarity:94/248 - (37%) Gaps:64/248 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FVLDF---------LCCV-----LAALTIAACSYALI--------------AFSHSVAIRVPSIL 49
            |:|:|         |||:     |..|....|...|:              .||.|......:.|
  Rat    83 FLLEFKKCNMARGCLCCLKYMMFLFNLIFWLCGCGLLGVGIWLSVSQGNFATFSPSFPSLSAANL 147

  Fly    50 GIVLGGLLFFSTIFGCIAALRESIRMTWIYAAILLALVFSQITVILAQPINYELLANETIYDAWQ 114
            .|.:|.::..:...||:.|::|:..:...:..:||.::.:::.:::...:..:.:......|..:
  Rat   148 VIAIGTIVMVTGFLGCLGAIKENKCLLLSFFIVLLIILLAELILLILFFVYMDKVNENAKQDLKE 212

  Fly   115 GQLYHS--------DRMSYFEIKYHCCGQTGPAN-YPDSG-LVIPQSCYFNQN----ATVTTDLY 165
            |.|.::        :..:..:.:..|||.|...: ||..| ..:|..|....:    ...||.|:
  Rat   213 GLLLYNTENNVGLKNAWNIIQAEMRCCGVTDYTDWYPVLGENTVPDRCCMENSQGCGRNSTTPLW 277

  Fly   166 TVGCNHQLAAAFVKGTRWEKITDW--------SVVGVEILTVIIAGL-LAITL 209
            ..||             :||:..|        ..||:..|.:.|.|: .::||
  Rat   278 KTGC-------------YEKVKLWFDDNKHVLGTVGMCFLIMQILGMAFSMTL 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EqNP_523643.2 Tetraspannin 8..209 CDD:278750 47/246 (19%)
tetraspanin_LEL 95..173 CDD:239401 17/91 (19%)
Tspan9NP_001101360.1 Tetraspannin 100..317 CDD:395265 41/229 (18%)
NET-5_like_LEL 196..293 CDD:239418 20/109 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.