DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eq and Tsp3A

DIOPT Version :9

Sequence 1:NP_523643.2 Gene:Tsp42Eq / 35628 FlyBaseID:FBgn0033138 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001245504.1 Gene:Tsp3A / 31244 FlyBaseID:FBgn0040334 Length:304 Species:Drosophila melanogaster


Alignment Length:249 Identity:53/249 - (21%)
Similarity:106/249 - (42%) Gaps:53/249 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TKALKVSSFVLDFLCCVLAALTIAACSYAL------------IAFSHSVAIRVPSILGIVLGGLL 57
            ::.:|...|:|:|:..:...|.:....||.            :...:.|.:.: |::.|:.|.::
  Fly    40 SQCVKYMIFLLNFVFWLFGGLLLGIGVYAFRDKWEDANGSVRLENFYDVFLNI-SLVMILAGTVI 103

  Fly    58 FFSTIFGCIAALRESIRMTWIYAAILLALVFSQITVILAQPINYELLANETIYDAWQGQLYHSDR 122
            |..:..||:.||||:..:...|:..||.....::.:.:...:..:.: |..:...:..::.||.|
  Fly   104 FLVSFSGCVGALRENTFLLKFYSMCLLLFFLLEMAIAIVCFVCPQYM-NTFLEKQFTHKIIHSYR 167

  Fly   123 --------MSYFEIKYHCCGQTGPANYPD----------SGLV----IPQSCYFNQNAT-VTTDL 164
                    :.:.:.::.|||.:. :.|.|          |..|    :|.||..  ||| :::.|
  Fly   168 DDPDLQNFIDFAQQEFKCCGLSN-SGYQDWSKNEYFNCSSPSVEKCGVPYSCCI--NATDISSGL 229

  Fly   165 YTVGCNHQLAAAFV-KGTRWEKITDWSVVGVEILTV-------IIAG-LLAITL 209
            ..:.|.:.:..|.| :.|:    ..|:...:||:.|       :||| .|.|.|
  Fly   230 VNIMCGYGVQNAPVPEATK----LIWTSGCIEIVRVWAEHNLYVIAGNALGIAL 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EqNP_523643.2 Tetraspannin 8..209 CDD:278750 52/244 (21%)
tetraspanin_LEL 95..173 CDD:239401 19/100 (19%)
Tsp3ANP_001245504.1 Tetraspannin 42..295 CDD:278750 53/247 (21%)
penumbra_like_LEL 144..267 CDD:239411 26/130 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.