DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eq and Tsp2A

DIOPT Version :9

Sequence 1:NP_523643.2 Gene:Tsp42Eq / 35628 FlyBaseID:FBgn0033138 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001188523.1 Gene:Tsp2A / 31080 FlyBaseID:FBgn0024361 Length:244 Species:Drosophila melanogaster


Alignment Length:222 Identity:51/222 - (22%)
Similarity:92/222 - (41%) Gaps:38/222 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 CCVLAALTIAACSYAL---------------IAFSHSVAIRVPSILGIVLGGLLFFSTIFGCIAA 68
            |..:.|..|:...:||               |..:.|..|.|..::||.:  ::...:..||::|
  Fly    25 CFNIVAWMISTALFALTVWLRAEPGFNDWLRILEAQSFYIGVYVLIGISI--VMMAVSFLGCLSA 87

  Fly    69 LRESIRMTWIYAAI----LLALVFSQITVILAQPINYEL--LANETI--YDAWQGQLYHSDRMSY 125
            |.|:....:::...    .:|:|.....::....||..|  |.|.::  :.|.....|.:..::.
  Fly    88 LMENTLALFVFVGTQVFGFIAIVAGSAVLLQFSTINSSLQPLLNVSLRGFVATSEYTYSNYVLTM 152

  Fly   126 FEIKYHCCGQTGPANYPDSGLVIPQSCYFNQNATVTTDLYTVGCNHQLAAAFVKGTRWEKITDWS 190
            .:....|||.|||.:|.|....:|.||    ..||:.:.:..||..:|...|      |..|.|.
  Fly   153 IQENIGCCGATGPWDYLDLRQPLPSSC----RDTVSGNAFFNGCVDELTWFF------EGKTGWI 207

  Fly   191 V---VGVEILTVIIAGLLAITLQNAER 214
            |   :.:.:|.||.|.:..:.:|..::
  Fly   208 VALAMTLGLLNVICAVMSFVLVQAVKK 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EqNP_523643.2 Tetraspannin 8..209 CDD:278750 50/215 (23%)
tetraspanin_LEL 95..173 CDD:239401 22/81 (27%)
Tsp2ANP_001188523.1 Tetraspannin 18..232 CDD:278750 51/218 (23%)
tetraspanin_LEL 116..204 CDD:239401 25/97 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.