DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eq and Tspan1

DIOPT Version :9

Sequence 1:NP_523643.2 Gene:Tsp42Eq / 35628 FlyBaseID:FBgn0033138 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001004236.1 Gene:Tspan1 / 298436 RGDID:1303308 Length:241 Species:Rattus norvegicus


Alignment Length:269 Identity:60/269 - (22%)
Similarity:94/269 - (34%) Gaps:87/269 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSCGTKALKVSSFVLDFLCCVLAALTIAACSYALIAFSHSVAIRVPSILG--------------- 50
            |.| .|.:||        ..:|..|.|..|..||:|....|::...|.|.               
  Rat     1 MQC-FKFIKV--------MMILFNLLIFLCGAALLAVGIWVSVDGTSFLKAFGSLSSSAMQFVNV 56

  Fly    51 ----IVLGGLLFFSTIFGCIAALRESIRMTWIYAAILLALVFSQIT-VILAQPINYELLANETI- 109
                |..|.:||.....||..|..|:..:..::.:|||.:..::|. .::|  :.|..:|.:.: 
  Rat    57 GYFLIAAGAVLFILGFLGCYGAHSENKCVLMMFFSILLIIFIAEIAGAVVA--LVYTTMAEQFLT 119

  Fly   110 ------------YDAWQGQLYHSDRMSYFEIKYHCCGQTGPANYPD--------SGLVIPQSCYF 154
                        |.....|:::|....     .||||..   ||.|        ...|.|..|..
  Rat   120 FLVVPAIEKDYGYQTEFTQVWNSTMEG-----LHCCGFN---NYTDFNSSRFVKENKVFPPFCCA 176

  Fly   155 NQNATVTTDLYTV--------------GCNHQLAAAFVKGTRWEKITDWSV-VGV---EILTVII 201
            |     .||.:||              ||..|:    ::..|...:|...| |||   |:..:::
  Rat   177 N-----NTDSHTVEPCTEDKAKSMNVQGCFKQI----LQKIRTNAVTVGGVAVGVAALELAAMVV 232

  Fly   202 AGLLAITLQ 210
            :..|...|:
  Rat   233 SMYLYCNLK 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EqNP_523643.2 Tetraspannin 8..209 CDD:278750 56/259 (22%)
tetraspanin_LEL 95..173 CDD:239401 23/112 (21%)
Tspan1NP_001004236.1 Tetraspannin 7..236 CDD:395265 55/255 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.