DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eq and tsp-13

DIOPT Version :9

Sequence 1:NP_523643.2 Gene:Tsp42Eq / 35628 FlyBaseID:FBgn0033138 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_741692.1 Gene:tsp-13 / 189737 WormBaseID:WBGene00006639 Length:321 Species:Caenorhabditis elegans


Alignment Length:198 Identity:42/198 - (21%)
Similarity:80/198 - (40%) Gaps:39/198 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LIAFSHSVAIRVPSILGIVLGGLLFFSTIFGCIAALRESIRMTWIYAAILLALVFSQIT------ 92
            |.|||:.:         ||||.::....:.||......|.....||:.::..|:.:.::      
 Worm   110 LFAFSYII---------IVLGAVMMVVAMLGCCGITGRSRPFLIIYSMVVFLLLVATLSCGIYLL 165

  Fly    93 -------VILAQPINYELLANETIYDAWQGQLYHSDRMSYFEIKYHCCGQTGPANYPDSGLVIPQ 150
                   |.|:..:||      .:...:||.....:.:.:.:..:.|||..|.:::......||:
 Worm   166 YKKDGLDVELSDALNY------MVQHYYQGPGVVQESLDHLQTAFRCCGNAGCSDFRVFRQDIPR 224

  Fly   151 SCYFNQNATVTTDLYTVGCNHQLAAAFVKGTRWEKITDWSVVGVEILTVIIAGLLAITLQNAERR 215
            ||          |:...||:.::..|...|.....|...:||..::||:..| |..:.::..|.:
 Worm   225 SC----------DIRCDGCHFRIMIALRIGFSVTLIVFSAVVLCQVLTICFA-LYFVFMREKEVK 278

  Fly   216 RLY 218
            .:|
 Worm   279 IIY 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EqNP_523643.2 Tetraspannin 8..209 CDD:278750 40/187 (21%)
tetraspanin_LEL 95..173 CDD:239401 16/77 (21%)
tsp-13NP_741692.1 Tetraspannin 58..269 CDD:278750 40/184 (22%)
tetraspanin_LEL 165..242 CDD:239401 18/92 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.