Sequence 1: | NP_523643.2 | Gene: | Tsp42Eq / 35628 | FlyBaseID: | FBgn0033138 | Length: | 219 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_741692.1 | Gene: | tsp-13 / 189737 | WormBaseID: | WBGene00006639 | Length: | 321 | Species: | Caenorhabditis elegans |
Alignment Length: | 198 | Identity: | 42/198 - (21%) |
---|---|---|---|
Similarity: | 80/198 - (40%) | Gaps: | 39/198 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 34 LIAFSHSVAIRVPSILGIVLGGLLFFSTIFGCIAALRESIRMTWIYAAILLALVFSQIT------ 92
Fly 93 -------VILAQPINYELLANETIYDAWQGQLYHSDRMSYFEIKYHCCGQTGPANYPDSGLVIPQ 150
Fly 151 SCYFNQNATVTTDLYTVGCNHQLAAAFVKGTRWEKITDWSVVGVEILTVIIAGLLAITLQNAERR 215
Fly 216 RLY 218 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Tsp42Eq | NP_523643.2 | Tetraspannin | 8..209 | CDD:278750 | 40/187 (21%) |
tetraspanin_LEL | 95..173 | CDD:239401 | 16/77 (21%) | ||
tsp-13 | NP_741692.1 | Tetraspannin | 58..269 | CDD:278750 | 40/184 (22%) |
tetraspanin_LEL | 165..242 | CDD:239401 | 18/92 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3882 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |