DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eq and TSPAN19

DIOPT Version :9

Sequence 1:NP_523643.2 Gene:Tsp42Eq / 35628 FlyBaseID:FBgn0033138 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001094387.1 Gene:TSPAN19 / 144448 HGNCID:31886 Length:248 Species:Homo sapiens


Alignment Length:206 Identity:53/206 - (25%)
Similarity:79/206 - (38%) Gaps:59/206 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LIAFSHSVAIRVPSILGIVLGGLLFFSTIFGCI---AALRESIRMTWIYAAILLALVFSQITVIL 95
            |.||..:....|| |..|::|  :..||:..|:   ..:...||...|..|:|:...|: :.|:|
Human    43 LTAFDENNHFIVP-ISQILIG--MGSSTVLFCLLGYIGIHNEIRWLLIVYAVLITWTFA-VQVVL 103

  Fly    96 AQPINYELLANETIYDAWQGQLYHSDRMSYFEIKY----------------------HCCGQTGP 138
            :.   :.:...|.:...|.      |::.:...:|                      .||||   
Human   104 SA---FIITKKEEVQQLWH------DKIDFVISEYGSKDKPEDITKWTILNALQKTLQCCGQ--- 156

  Fly   139 ANYPD---------SGLVIPQSCYFNQNATVTTDLYTVGCNHQLAAAFVKGTRWEKITDWSVVGV 194
            .||.|         ||.| |.||      |.:| |....|:..|.|.:::|.. .||:.|..|.|
Human   157 HNYTDWIKNKNKENSGQV-PCSC------TKST-LRKWFCDEPLNATYLEGCE-NKISAWYNVNV 212

  Fly   195 EILTVIIAGLL 205
            ..|..|..|||
Human   213 LTLIGINFGLL 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EqNP_523643.2 Tetraspannin 8..209 CDD:278750 53/206 (26%)
tetraspanin_LEL 95..173 CDD:239401 22/108 (20%)
TSPAN19NP_001094387.1 Tetraspannin 9..240 CDD:278750 53/206 (26%)
CD37_CD82_like_LEL 107..212 CDD:239413 28/122 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.