DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eq and tsp-6

DIOPT Version :9

Sequence 1:NP_523643.2 Gene:Tsp42Eq / 35628 FlyBaseID:FBgn0033138 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001294830.1 Gene:tsp-6 / 13219712 WormBaseID:WBGene00006632 Length:237 Species:Caenorhabditis elegans


Alignment Length:233 Identity:55/233 - (23%)
Similarity:98/233 - (42%) Gaps:41/233 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CGTKALKVSSFVLDFLCCVLAALTIAACSYALI------AFSHSVAIRVPSIL------------ 49
            ||.|.:|...::::||..||.|:.:....:.|:      ..:.:|.:.:..||            
 Worm     5 CGNKCVKYFFWLINFLFFVLGAIIVGLSIWMLVDKNSLNTVASTVKVDLSQILSQVNIQQLNSFL 69

  Fly    50 --GIVLGGLLFFSTIFGCIAALRESIRMTWIYAAILLALVFSQITVILAQPINYELLAN--ETIY 110
              .||:||.|.....|||..:..|||....||..::|.|...::..|:...:|...|..  :|| 
 Worm    70 YVAIVIGGALLVLGFFGCCGSCCESICAISIYFILVLILFVVEVVAIVLYFVNKTNLQQGFQTI- 133

  Fly   111 DAWQGQL---YHSDR-----MSYFEIKYHCCGQTGPANYPDSGLVIPQSCYFNQNATVTTDLYTV 167
              |:.:|   |::.:     :...:....|||.:|.::|...| ..|.||   |.||:    ...
 Worm   134 --WRDELVSKYNTQQQIHQVLDQIQSSLQCCGASGCSDYIPYG-AFPTSC---QCATI----QQA 188

  Fly   168 GCNHQLAAAFVKGTRWEKITDWSVVGVEILTVIIAGLL 205
            ||...:..:|.....:.......::.||:|.:|.:.::
 Worm   189 GCATVIWNSFESSLIYVAFVGIIILFVELLAMIFSCII 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EqNP_523643.2 Tetraspannin 8..209 CDD:278750 52/228 (23%)
tetraspanin_LEL 95..173 CDD:239401 21/87 (24%)
tsp-6NP_001294830.1 Tetraspannin 9..227 CDD:278750 52/229 (23%)
tetraspanin_LEL 120..202 CDD:239401 22/92 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.