DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eq and Cd82

DIOPT Version :9

Sequence 1:NP_523643.2 Gene:Tsp42Eq / 35628 FlyBaseID:FBgn0033138 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001129527.1 Gene:Cd82 / 12521 MGIID:104651 Length:266 Species:Mus musculus


Alignment Length:265 Identity:55/265 - (20%)
Similarity:92/265 - (34%) Gaps:79/265 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSCG-TKALKVSSFVLDFLCCVLAALTIA--------ACSYALIAFSHSVAIRVPSILGIVLGGL 56
            |..| .|..|...|:.:.|..:|.|:.:.        ..|:..:..:.|.:::|.:.:.|.:|.:
Mouse     1 MGAGCVKVTKYFLFLFNLLFFILGAVILGFGVWILADKNSFISVLQTSSSSLQVGAYVFIGVGAI 65

  Fly    57 LFFSTIFGCIAALRESIRMTWIYAAILLALVFSQITVILAQPINYELLANE---TIYD------- 111
            .......|||.|:.|...:..:|...||.::.:|:||.:....|.:.|..|   |:.|       
Mouse    66 TIVMGFLGCIGAVNEVRCLLGLYFVFLLLILIAQVTVGVLFYFNADKLKKEMGNTVMDIIRNYTA 130

  Fly   112 --------AWQGQLYHSDRMSYFEIKYHCCGQTGPAN--------------YP---------DSG 145
                    ||          .|.:.:..|||.....|              ||         |:.
Mouse   131 NATSSREEAW----------DYVQAQVKCCGWVSHYNWTENEELMGFTKTTYPCSCEKIKEEDNQ 185

  Fly   146 LVIPQSCYFNQNATVTTD------LYTVGCNHQLAAAFVKGTRWEKITDWSVVGVEILTVIIAGL 204
            |::.:......|:||:.:      :.|.||             .||...|......||..:.||:
Mouse   186 LIVKKGFCEADNSTVSENNPEDWPVNTEGC-------------MEKAQAWLQENFGILLGVCAGV 237

  Fly   205 LAITL 209
            ..|.|
Mouse   238 AVIEL 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EqNP_523643.2 Tetraspannin 8..209 CDD:278750 51/255 (20%)
tetraspanin_LEL 95..173 CDD:239401 22/124 (18%)
Cd82NP_001129527.1 CD37_CD82_like_LEL 106..228 CDD:239413 25/144 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.