DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eq and Cd37

DIOPT Version :9

Sequence 1:NP_523643.2 Gene:Tsp42Eq / 35628 FlyBaseID:FBgn0033138 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_006540655.1 Gene:Cd37 / 12493 MGIID:88330 Length:396 Species:Mus musculus


Alignment Length:284 Identity:67/284 - (23%)
Similarity:102/284 - (35%) Gaps:82/284 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SCGTKALKVSSFVLDFLCCVLAALTIAACSYALI---AFSHSVAIR-VP----SILGIVLGGLLF 58
            || ...:|...||.:....||..|.....::.||   :|...|.:. ||    |.:..|.|.|..
Mouse    28 SC-LSLIKYFLFVFNLFFFVLGGLIFCFGTWILIDKTSFVSFVGLSFVPLQTWSKVLAVSGVLTM 91

  Fly    59 FSTIFGCIAALRESIRMTWIYAAILLALVFSQIT---VILAQPINYELLANETIYDAWQGQLYHS 120
            ...:.||:.||:|...:..:|..:||.|..:|||   :|..|.:..|....|.:....|....:.
Mouse    92 ALALLGCVGALKELRCLLGLYFGMLLLLFATQITLGILISTQRVRLERRVQELVLRTIQSYRTNP 156

  Fly   121 DRMS------YFEIKYHCCGQTGPANYPDSGLV---------IPQSCYFNQNATVTTD------- 163
            |..:      |.:.:..|||...|.::..:.::         :|.|||   |:|.|.|       
Mouse   157 DETAAEESWDYAQFQLRCCGWQSPRDWNKAQMLKANESEEPFVPCSCY---NSTATNDSTVFDKL 218

  Fly   164 ----------------------------LYTVGCNHQLAAAFVKGTRWEKITDWSVVGVEILTVI 200
                                        :|..||...|       .:|......|:||:    .:
Mouse   219 FFSQLSRLGPRAKLRQTADICALPAKAHIYREGCAQSL-------QKWLHNNIISIVGI----CL 272

  Fly   201 IAGLL-----AITLQNAERRRLYR 219
            ..|||     |:.|| .:||.|.|
Mouse   273 GVGLLEVSGMALCLQ-LQRRALAR 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EqNP_523643.2 Tetraspannin 8..209 CDD:278750 59/266 (22%)
tetraspanin_LEL 95..173 CDD:239401 21/127 (17%)
Cd37XP_006540655.1 CD37_CD82_like_LEL 130..265 CDD:239413 24/144 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.