DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eq and si:ch73-139j3.4

DIOPT Version :9

Sequence 1:NP_523643.2 Gene:Tsp42Eq / 35628 FlyBaseID:FBgn0033138 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_005164654.1 Gene:si:ch73-139j3.4 / 101884436 ZFINID:ZDB-GENE-140106-202 Length:355 Species:Danio rerio


Alignment Length:223 Identity:47/223 - (21%)
Similarity:84/223 - (37%) Gaps:58/223 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 VLAALTIAACSYALIAFSHSVAIRVPSI---LGIVLGGLLFFS------TIFGCIAALRESIRMT 76
            |:..::|.||| |.|.|.....:.|.|.   :.:|.|||.|..      ::.||..|..||....
Zfish    22 VILGISIFACS-AWILFDKDSFVSVLSSGQEVKVVAGGLFFIGLVVVGVSLLGCAGAYFESRCFI 85

  Fly    77 WIYAAILLALVFSQ--ITVILAQPINYELLANETIYDAWQGQL------YHSDR-------MSYF 126
            ..|.:.|:.::..|  ||.:|       |:..:||....:.::      |..|.       :...
Zfish    86 IFYLSFLIVIILGQIFITFVL-------LIRRKTIEQFLRDKVDEIIKQYGGDEIQTSWKLLDSV 143

  Fly   127 EIKYHCCGQTGPANYPDSGL--------VIPQSCYFNQNATVT----------TDLYTVGCNHQL 173
            :....|||:.....:.::.:        :.|.|| ||....|.          :|::..||...|
Zfish   144 QTSARCCGRLNSNEWRNNTVIASLGGTDIYPCSC-FNGTCPVILEETYSFGNGSDVFERGCEETL 207

  Fly   174 AAAFVKGTRWEKITDWSVVGVEILTVII 201
                   ..|.::....:.|:::..::|
Zfish   208 -------VNWLEMNIIVIFGMDVALILI 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EqNP_523643.2 Tetraspannin 8..209 CDD:278750 47/223 (21%)
tetraspanin_LEL 95..173 CDD:239401 18/108 (17%)
si:ch73-139j3.4XP_005164654.1 Tetraspannin 10..237 CDD:306775 47/223 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.