DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eq and TSPAN1

DIOPT Version :9

Sequence 1:NP_523643.2 Gene:Tsp42Eq / 35628 FlyBaseID:FBgn0033138 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_011538762.1 Gene:TSPAN1 / 10103 HGNCID:20657 Length:258 Species:Homo sapiens


Alignment Length:213 Identity:49/213 - (23%)
Similarity:75/213 - (35%) Gaps:64/213 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SFVLDFLCCVLAALTIAACSYALIAFSHSVAIRVPSILGI------------------VLGGLLF 58
            ||:...:  :|..|.|..|..||:|....|:|...|.|.|                  :..|::.
Human     5 SFIKTMM--ILFNLLIFLCGAALLAVGIWVSIDGASFLKIFGPLSSSAMQFVNVGYFLIAAGVVV 67

  Fly    59 FSTIF-GCIAALRES--IRMTWIY----------AAILLALVFSQ-----ITVILAQPINYELLA 105
            |:..| ||..|..||  ..:|:.:          ||.::|||::.     :|:::...|..:..:
Human    68 FALGFLGCYGAKTESKCALVTFFFILLLIFIAEVAAAVVALVYTTMAEHFLTLLVVPAIKKDYGS 132

  Fly   106 NETIYDAWQGQLYHSDRMSYFEIKYHCCGQTGPANYPDS-----GLVIPQSCYFNQNATVTT--- 162
            .|.....|...:.          ...|||.|...::.||     ....|..| .|.|.|.|.   
Human   133 QEDFTQVWNTTMK----------GLKCCGFTNYTDFEDSPYFKENSAFPPFC-CNDNVTNTANET 186

  Fly   163 -------DLYTVGCNHQL 173
                   |....||.:||
Human   187 CTKQKAHDQKVEGCFNQL 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EqNP_523643.2 Tetraspannin 8..209 CDD:278750 49/213 (23%)
tetraspanin_LEL 95..173 CDD:239401 18/92 (20%)
TSPAN1XP_011538762.1 Tetraspannin 7..214 CDD:278750 47/211 (22%)
uroplakin_I_like_LEL 110..212 CDD:239409 21/106 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.