DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eq and cd37

DIOPT Version :9

Sequence 1:NP_523643.2 Gene:Tsp42Eq / 35628 FlyBaseID:FBgn0033138 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001096092.1 Gene:cd37 / 100124595 ZFINID:ZDB-GENE-070820-17 Length:249 Species:Danio rerio


Alignment Length:241 Identity:56/241 - (23%)
Similarity:91/241 - (37%) Gaps:65/241 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CGTKALKVSSFVLDFLCCVLAALTIAACSYALIA-----------FSHSVAIRVPSILGIVLGGL 56
            |.....|...|:.:.:..:|.:|.:::..:.|::           |...::|.:.|.|.|:.|.:
Zfish     5 CCVSVTKYFLFLFNLVFFLLGSLLLSSGLWMLLSDTSEIKTFIDPFRPYISISLLSYLLIISGSV 69

  Fly    57 LFFSTIFGCIAALRESIRMTWIYAAILLALVFSQITVILAQPI---------NYEL---LANET- 108
            ......|||:.:|:.        ...|||:.|..:||:||..|         ..||   |..|| 
Zfish    70 TMSLGFFGCLGSLKT--------VKFLLAIYFILLTVLLAAQIVGGVLFYTMKTELSKSLGKETD 126

  Fly   109 -IYDAWQGQLYHSDRMSYFEIKYHCCGQTGPANYPDSGLVIPQSCYFNQNAT------------- 159
             |....:........|.|.:.:..|||..|..::.||   ||.|||...|.|             
Zfish   127 LIQSFGRNDSSFKKTMDYIQRQEECCGWNGKEDWGDS---IPCSCYHKANETKELCDNCSPDFFY 188

  Fly   160 --VTTDLYTVGCNHQLAAAFVKGTRWEKITDWSVVGVE-ILTVIIA 202
              ::..:|..||.             :|:.:|....:. ||.||:|
Zfish   189 PVLSCKIYDEGCK-------------DKVENWLGSNLHFILWVILA 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EqNP_523643.2 Tetraspannin 8..209 CDD:278750 55/236 (23%)
tetraspanin_LEL 95..173 CDD:239401 27/106 (25%)
cd37NP_001096092.1 Tetraspannin 55..238 CDD:278750 49/191 (26%)
tetraspanin_LEL 110..212 CDD:243179 26/117 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.