DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgant3 and galnt10

DIOPT Version :9

Sequence 1:NP_610256.1 Gene:Pgant3 / 35627 FlyBaseID:FBgn0027558 Length:667 Species:Drosophila melanogaster
Sequence 2:NP_001070072.1 Gene:galnt10 / 767665 ZFINID:ZDB-GENE-030131-595 Length:261 Species:Danio rerio


Alignment Length:173 Identity:94/173 - (54%)
Similarity:116/173 - (67%) Gaps:3/173 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 GEGADGRPVVVPPRDRFRMQRFFRLNSFNLLASDRIPLNRTLKDYRTPECRDKKYASGLPSTSVI 155
            |.|..|||  .|..|..|:.:.:|.|.||:..||||.|||:|.|.|.|.|:.|.|.:.||:||||
Zfish    79 GAGEQGRP--YPLTDAERVDQAYRENGFNIFVSDRIALNRSLPDIRHPNCKLKLYTADLPNTSVI 141

  Fly   156 IVFHNEAWSVLLRTITSVINRSPRHLLKEIILVDDASDRSYLKRQLESYVKVLAVPTRIFRMKKR 220
            |.||||.||.||||:.||::|||..|:.|||||||.||:.:||..||.|: |.....||.|.:||
Zfish   142 IPFHNEGWSSLLRTVHSVLDRSPPSLIAEIILVDDFSDKGHLKAPLEQYM-VRLPKVRILRTQKR 205

  Fly   221 SGLVPARLLGAENARGDVLTFLDAHCECSRGWLEPLLSRIKES 263
            .||:..|||||..|||.|:||||:|||.:..||.|||.||.::
Zfish   206 EGLIRTRLLGAAAARGQVITFLDSHCEANVNWLPPLLDRIAQN 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgant3NP_610256.1 Glyco_tranf_2_3 150..386 CDD:290369 67/114 (59%)
pp-GalNAc-T 153..457 CDD:133004 65/111 (59%)
Ricin_B_lectin 516..658 CDD:279046
RICIN 524..660 CDD:238092
galnt10NP_001070072.1 WcaA 134..>260 CDD:223539 68/116 (59%)
Glyco_tranf_GTA_type 139..>253 CDD:299700 65/111 (59%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.