DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgant3 and GALNT9

DIOPT Version :9

Sequence 1:NP_610256.1 Gene:Pgant3 / 35627 FlyBaseID:FBgn0027558 Length:667 Species:Drosophila melanogaster
Sequence 2:NP_001116108.1 Gene:GALNT9 / 50614 HGNCID:4131 Length:603 Species:Homo sapiens


Alignment Length:395 Identity:154/395 - (38%)
Similarity:218/395 - (55%) Gaps:35/395 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 IGKGDIFGNMTADDYNINLFQPINGEGADGRPVVVPPRDRFRMQRFFRLNSFNLLASDRIPLNRT 131
            :|:|.:...:..|           |:.|:|:               :....:|...||||.|:|:
Human    94 LGQGGLAATLRDD-----------GQEAEGK---------------YEEYGYNAQLSDRISLDRS 132

  Fly   132 LKDYRTPECRDKKYASGLPSTSVIIVFHNEAWSVLLRTITSVINRSPRHLLKEIILVDDASDRSY 196
            :.|||..:||...||..||..||:.:|.|||.||:||::.||:|.:|..||||:|||||.||...
Human   133 IPDYRPRKCRQMSYAQDLPQVSVVFIFVNEALSVILRSVHSVVNHTPSQLLKEVILVDDNSDNVE 197

  Fly   197 LKRQLESYV-KVLAVPTRIFRMKKRSGLVPARLLGAENARGDVLTFLDAHCECSRGWLEPLLSRI 260
            ||..|:.|| |......:|.|..:|.||:.|||.|.:.|...|:.|.|||.|.:.||.||.||||
Human   198 LKFNLDQYVNKRYPGLVKIVRNSRREGLIRARLQGWKAATAPVVGFFDAHVEFNTGWAEPALSRI 262

  Fly   261 KESRKVVICPVIDIISDDNFSYTKTFENHWGAFNWQLSFRWFSSDRKRQTAGNSSKDSTDPIATP 325
            :|.|:.::.|.||.|....|. .:.:.|....:||.|...:....:.....|    |.:.||.||
Human   263 REDRRRIVLPAIDNIKYSTFE-VQQYANAAHGYNWGLWCMYIIPPQDWLDRG----DESAPIRTP 322

  Fly   326 GMAGGLFAIDRKYFYEMGSYDSNMRVWGGENVEMSFRIWQCGGRVEISPCSHVGHVFRSSTPYTF 390
            .|.|..|.:||:||.::|..|..|.|:||||||:..|:|||||.:|:.|||.|.|:.|:..||. 
Human   323 AMIGCSFVVDREYFGDIGLLDPGMEVYGGENVELGMRVWQCGGSMEVLPCSRVAHIERTRKPYN- 386

  Fly   391 PGGMSEVLTDNLARAATVWMDDWQ-YFIMLYTSGLTLGAKDKVNVTERVALRERLQCKPFSWYLE 454
             ..:......|..|||.|||||:: :..|.:...::....|..:|:||:|||:||:|:.|.||||
Human   387 -NDIDYYAKRNALRAAEVWMDDFKSHVYMAWNIPMSNPGVDFGDVSERLALRQRLKCRSFKWYLE 450

  Fly   455 NIWPE 459
            |::||
Human   451 NVYPE 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgant3NP_610256.1 Glyco_tranf_2_3 150..386 CDD:290369 103/236 (44%)
pp-GalNAc-T 153..457 CDD:133004 130/305 (43%)
Ricin_B_lectin 516..658 CDD:279046
RICIN 524..660 CDD:238092
GALNT9NP_001116108.1 Catalytic subdomain A 150..261 54/110 (49%)
pp-GalNAc-T 154..453 CDD:133004 130/305 (43%)
Catalytic subdomain B 318..380 33/61 (54%)
Ricin_B_lectin 464..592 CDD:279046
RICIN 466..594 CDD:238092
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.