DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgant3 and Galntl5

DIOPT Version :9

Sequence 1:NP_610256.1 Gene:Pgant3 / 35627 FlyBaseID:FBgn0027558 Length:667 Species:Drosophila melanogaster
Sequence 2:NP_001020319.1 Gene:Galntl5 / 499968 RGDID:1565271 Length:443 Species:Rattus norvegicus


Alignment Length:397 Identity:161/397 - (40%)
Similarity:231/397 - (58%) Gaps:45/397 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 KGDIFGNMTADDYNINLFQPINGEGADGRPVVVPPRDRFRMQRFFRLNSFNLLASDRIPLNRTLK 133
            ||||                ||.......|.::....|:         ..|::.|.|:.:.|.:.
  Rat    64 KGDI----------------INDRAMFSDPELIQGLSRY---------GLNVITSRRLGIERQVP 103

  Fly   134 DYRTPECRDKKYASGLPSTSVIIVFHNEAWSVLLRTITSVINRSPRHLLKEIILVDDASDRSYLK 198
            |.|...|:.|.|...||:.||||.|:||.::.||||::||:|.||:|||:|||||||.|:...||
  Rat   104 DSRNKICQQKHYPFNLPTASVIICFYNEEFNTLLRTVSSVMNLSPKHLLEEIILVDDMSEFDDLK 168

  Fly   199 RQLESYVKVLAVPTRIFRMKKRSGLVPARLLGAENARGDVLTFLDAHCECSRGWLEPLLSRIKES 263
            .:|:.::::.....::.|.|||.||:.:|::||..|.||:|.|||:|||.:|.||||||..|.:.
  Rat   169 AKLDYHLEIFRGKIKLVRNKKREGLIRSRMIGASRASGDILVFLDSHCEVNRVWLEPLLHAIAKD 233

  Fly   264 RKVVICPVIDIISDDNFSYTKTFENHWGAFNWQLSFRW---FSSDRKRQTAGNSSKDSTDPIATP 325
            .|:|:|||||:|.:....|..: ....|||:|.|:|||   ||.:.      :..:..:.||.:|
  Rat   234 HKMVVCPVIDVIDELTLDYVGS-PIVRGAFDWNLNFRWDDVFSYEL------DGPEGPSTPIRSP 291

  Fly   326 GMAGGLFAIDRKYFYEMGSYDSNMRVWGGENVEMSFRIWQCGGRVEISPCSHVGHVFRSSTPYTF 390
            .|:||:|||:|.||.|:|.||.:|.:|||||||:|.|||.|||::.|.|||.|||..::.:....
  Rat   292 AMSGGIFAINRHYFNELGQYDKDMDLWGGENVELSLRIWMCGGQLFILPCSRVGHNNKALSKNRL 356

  Fly   391 PGGMSEVLTDNLARAATVWMDDWQYFIMLYTSGLT---LGAKDKVNVTERVALRERLQCKPFSWY 452
            ..  ...|:.||.|...||:|:::....|....||   .|     |:::||.||:||.||.|.||
  Rat   357 VN--QSALSKNLLRVVHVWLDEYKENFFLQRPSLTHVSCG-----NISDRVELRKRLGCKSFQWY 414

  Fly   453 LENIWPE 459
            |:||:||
  Rat   415 LDNIFPE 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgant3NP_610256.1 Glyco_tranf_2_3 150..386 CDD:290369 115/238 (48%)
pp-GalNAc-T 153..457 CDD:133004 139/309 (45%)
Ricin_B_lectin 516..658 CDD:279046
RICIN 524..660 CDD:238092
Galntl5NP_001020319.1 pp-GalNAc-T 123..419 CDD:133004 139/309 (45%)
Glyco_tranf_2_3 123..355 CDD:290369 114/238 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D606683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.