DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgant3 and Galnt6

DIOPT Version :9

Sequence 1:NP_610256.1 Gene:Pgant3 / 35627 FlyBaseID:FBgn0027558 Length:667 Species:Drosophila melanogaster
Sequence 2:NP_001165534.1 Gene:Galnt6 / 100361647 RGDID:2319726 Length:622 Species:Rattus norvegicus


Alignment Length:572 Identity:227/572 - (39%)
Similarity:304/572 - (53%) Gaps:105/572 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 QPINGEGADGRPVVVPPRDRFRMQRF-----------FRLNSFNLLASDRIPLNRTL-KDYRTPE 139
            |..|..||||:        .|:.:.:           ::.:.||..|||||.|.|:| .|.|.||
  Rat   108 QDPNSPGADGK--------AFQKKEWTLLETQEKDEGYKKHCFNAFASDRISLQRSLGPDTRPPE 164

  Fly   140 CRDKKY--ASGLPSTSVIIVFHNEAWSVLLRTITSVINRSPRHLLKEIILVDDASDRSYLKRQLE 202
            |.|:|:  ...||:|||:|||||||||.||||:.||::.||..||||||||||||...:||.:||
  Rat   165 CVDQKFRRCPPLPTTSVVIVFHNEAWSTLLRTVYSVLHTSPAILLKEIILVDDASTDEHLKEKLE 229

  Fly   203 SYVKVLAVPTRIFRMKKRSGLVPARLLGAENARGDVLTFLDAHCECSRGWLEPLLSRIKESRKVV 267
            .||:.|.: .|:.|.::|.||:.||||||..|:.:|||||||||||..|||||||:||.|.:..|
  Rat   230 RYVQQLQI-VRVVRQQERKGLITARLLGASVAQAEVLTFLDAHCECFHGWLEPLLARIAEDKTAV 293

  Fly   268 ICPVIDIISDDNFSYTKTFE----NHWGAFNWQLSFRW-FSSDRKRQTAGNSSKDSTDPIATPGM 327
            :.|.|..|..:.|.::|...    :..|.|:|.|:|.| ...:.::|    ..||.|.||.:|..
  Rat   294 VSPDIVTIDLNTFQFSKPMRRGKAHSRGNFDWSLTFGWEMLPEHEKQ----RRKDETYPIKSPTF 354

  Fly   328 AGGLFAIDRKYFYEMGSYDSNMRVWGGENVEMSFRIWQCGGRVEISPCSHVGHVFRSSTPYTFPG 392
            |||||:|.:.||..:|:||:.|.:|||||||||||:|||||::||.|||.||||||:.:|:|||.
  Rat   355 AGGLFSISKAYFEHIGTYDNQMEIWGGENVEMSFRVWQCGGQLEIIPCSVVGHVFRTKSPHTFPK 419

  Fly   393 GMSEVLTDNLARAATVWMDDWQYFIMLYTSGLTLGAKDKVN----VTERVALRERLQCKPFSWYL 453
            |.| |:..|..|.|.|||||  |..:.|...|......|.|    |:||:.|||:|.|..|||||
  Rat   420 GTS-VIARNQVRLAEVWMDD--YKKIFYRRNLQAAKMAKENNFGDVSERLRLREQLHCHNFSWYL 481

  Fly   454 ENIWPEHFFPAPDRFFGKIIWLDGETECAQA------------YSKHMKNLPGRALSREWKRAFE 506
            .|::||.|.|..:..|...|...|.::|...            |..|  ||.|       .:.||
  Rat   482 HNVYPEMFVPDLNPTFSGAIKNLGTSQCLDVGENNRGGKPLIMYVCH--NLGG-------NQYFE 537

  Fly   507 EIDSKAEELMALIDLE----RDKCLRPLKEDVPRSSLSAVTVGDC-----TSHAQSMDMFVITPK 562
            ....:        ||.    :..||        .:|.|.:.:.:|     .|.....:.:.:| :
  Rat   538 YTSQR--------DLRHNIGKQLCL--------HASGSTLGLRNCQFIGKNSEVPKDEEWELT-Q 585

  Fly   563 GQIMTN--DNVCLTYRQQKLGVIKMLKNRNATTSNVMLAQC-ASDSSQLWTY 611
            .|::.|  ...|||.:.:|                ..:|.| .||..|||.:
  Rat   586 DQLIRNLGSGTCLTSKDKK----------------PAMAPCNPSDPYQLWLF 621

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgant3NP_610256.1 Glyco_tranf_2_3 150..386 CDD:290369 131/240 (55%)
pp-GalNAc-T 153..457 CDD:133004 163/312 (52%)
Ricin_B_lectin 516..658 CDD:279046 22/108 (20%)
RICIN 524..660 CDD:238092 20/96 (21%)
Galnt6NP_001165534.1 pp-GalNAc-T 180..485 CDD:133004 163/312 (52%)
Ricin_B_lectin 497..619 CDD:395527 31/163 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D606683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11675
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.