DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgant3 and galnt5

DIOPT Version :9

Sequence 1:NP_610256.1 Gene:Pgant3 / 35627 FlyBaseID:FBgn0027558 Length:667 Species:Drosophila melanogaster
Sequence 2:XP_002667267.4 Gene:galnt5 / 100334784 -ID:- Length:768 Species:Danio rerio


Alignment Length:372 Identity:161/372 - (43%)
Similarity:211/372 - (56%) Gaps:23/372 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 GADGRPVVVPPRDRFRMQRFFRLNSFNLLASDRIPLNRTLKDYRTPECRDKKYASGLPSTSVIIV 157
            |..|:|..||..:....:|.:....||:..|::||::|.:.|.|...|.:......|||||||..
Zfish   284 GQFGQPARVPKNEELESRRRWSEGFFNVFLSEQIPIDRAIPDTRPQTCSESLVHDDLPSTSVIFC 348

  Fly   158 FHNEAWSVLLRTITSVINRSPRHLLKEIILVDDASDRSYLKRQLESYVKVLAVPTRIFRMKKRSG 222
            |.:|.||.|||::.||:||||..||||||||||.|.:.|||.||:.|:.... ..||..:|:|.|
Zfish   349 FVDEVWSTLLRSVHSVLNRSPPQLLKEIILVDDCSTKDYLKEQLDVYMSQFP-KVRIIHLKERQG 412

  Fly   223 LVPARLLGAENARGDVLTFLDAHCECSRGWLEPLLSRIKESRKVVICPVIDIISDDNFSYTKTFE 287
            |:.||:.||..|.|:||||||:|.||:.|||||||.||...|:.|.|||||:|:|.:.||.....
Zfish   413 LIRARMAGAAAATGEVLTFLDSHIECNVGWLEPLLERIYLDRRKVPCPVIDVINDKDMSYMLVDN 477

  Fly   288 NHWGAFNWQLSFRWFSSDRKRQTAGNSSKDSTDPIATPGMAGGLFAIDRKYFYEMGSYDSNMRVW 352
            ...|.|.|.|.|.| |:..:.....|..||| |||.....           |.......:|.:..
Zfish   478 FQRGIFKWPLVFGW-SALPEEYIQKNQIKDS-DPIRIACC-----------FIHSHILHNNRKKS 529

  Fly   353 GGENVEM-SFRIWQCGGRVEISPCSHVGHVFRSSTPYTFPGGMSEVLTDNLARAATVWMDDWQYF 416
            |  ||.: .|:||.|||.:||.|||.|||:|||..||.|.....:.:..||||.|.||:|  :|.
Zfish   530 G--NVFLFVFQIWMCGGEIEIIPCSRVGHIFRSDNPYKFTKDRVKTVERNLARVAEVWLD--EYK 590

  Fly   417 IMLYTSG----LTLGAKDKVNVTERVALRERLQCKPFSWYLENIWPE 459
            .:.|..|    |.....|..|:||::.|||:|:||.|.|||||::|:
Zfish   591 EVFYGHGYQHLLDKNVTDIGNLTEQIQLREKLKCKSFKWYLENVYPD 637

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgant3NP_610256.1 Glyco_tranf_2_3 150..386 CDD:290369 113/236 (48%)
pp-GalNAc-T 153..457 CDD:133004 141/308 (46%)
Ricin_B_lectin 516..658 CDD:279046
RICIN 524..660 CDD:238092
galnt5XP_002667267.4 Glyco_tranf_GTA_type 344..635 CDD:325014 141/308 (46%)
Ricin_B_lectin 647..761 CDD:306998
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D194016at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.