DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ep and Tsp74F

DIOPT Version :9

Sequence 1:NP_001260759.1 Gene:Tsp42Ep / 35626 FlyBaseID:FBgn0033137 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster


Alignment Length:272 Identity:60/272 - (22%)
Similarity:98/272 - (36%) Gaps:101/272 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNGCYNTIKYTGLLSNLLYM----------------------LLGIGVMSGAGLGLQMAEPNTPE 43
            |:.|...:||:..::|.:..                      |||..:.|||            .
  Fly     7 MDCCGQFVKYSLFIANFVIFVGGAIVFCLTLWTLVDRSFVNELLGTNLFSGA------------V 59

  Fly    44 HTYFVKSLVLGGSICMIVMFGCYGMVANLLCVNLIFTMFILIALAAEYLQLHHYHSPSLRSPGGA 108
            :...|.|::    ||::...||.|....:.|  |:.|.||::||....:.:           ||.
  Fly    60 YVLLVTSII----ICLVSFLGCVGAGKEVKC--LLLTYFIIVALVFVTMLI-----------GGV 107

  Fly   109 W-------------QQLE--LAWHGLDRDPELMHQYEASQ---HCCGYNGADDYKRLHLLVPASC 155
            .             |::.  :|.:|..|  |:...::.:|   .|||.:...|:.| :..||.||
  Fly   108 LGYVFRERVQQTMRQEMRSTMALYGSRR--EITQAWDLTQERLQCCGVDTWHDWNR-YGPVPESC 169

  Fly   156 YQ---------AAVNDTAQQIYPSGCLETLNRSQRYIQHRDKLYMWAIVG--------LEIFILL 203
            .|         ..:..|...:|..|||..   :..:|  ||..   |::|        |.||.::
  Fly   170 CQELFGGQRKECTIFPTITNLYNQGCLYV---TTNFI--RDHA---AVIGGTSIAVAILMIFGMI 226

  Fly   204 QTVALSVLLFRL 215
                .|.|||.:
  Fly   227 ----FSCLLFNM 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EpNP_001260759.1 Tetraspannin <51..213 CDD:278750 45/196 (23%)
tetraspanin_LEL 91..183 CDD:239401 23/118 (19%)
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 55/260 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.