DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eo and TSPAN10

DIOPT Version :9

Sequence 1:NP_523641.2 Gene:Tsp42Eo / 35625 FlyBaseID:FBgn0033136 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001277141.2 Gene:TSPAN10 / 83882 HGNCID:29942 Length:355 Species:Homo sapiens


Alignment Length:235 Identity:46/235 - (19%)
Similarity:82/235 - (34%) Gaps:72/235 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 IVGVLAALAGVYELDKFNE-----GSAEHTEKFVQLGMAGALILA-GLVGCLGAI---------- 69
            ::|:||...|::.|.....     |.....:..:.|.:.|.::.| .|.|.|||:          
Human    89 LLGLLALAIGLWGLAVKGSLGSDLGGPLPADPMLGLALGGLVVSAVSLAGYLGALCENTCLLRGF 153

  Fly    70 FGSIKVMVVNLILLLALIASHIW-------------KVSHYNETKQLDATEVYVMDLWMKELVHH 121
            .|.|...:|...:..||:.: :|             .::||.:...|.    :::|         
Human   154 SGGILAFLVLEAVAGALVVA-LWGPLQDSLEHTLRVAIAHYQDDPDLR----FLLD--------- 204

  Fly   122 GAMQDLQQEYECCGDKGFSDYTSLNM------------KVPRSCF--HTKDGIHALYPYGEGCM- 171
                .:|....|||...:.|:.. |:            .:|.||.  ..:||.......|.|.: 
Human   205 ----QVQLGLRCCGAASYQDWQQ-NLYFNCSSPGVQACSLPASCCIDPREDGASVNDQCGFGVLR 264

  Fly   172 ----AAVKRAYLQIY--RYEKWVHCGLI---GYEVVGIIL 202
                ||.:..||:..  ...:|:...|.   ||.:..::|
Human   265 LDADAAQRVVYLEGCGPPLRRWLRANLAASGGYAIAVVLL 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EoNP_523641.2 Tetraspannin 7..210 CDD:278750 46/235 (20%)
tetraspanin_LEL 110..178 CDD:239401 16/86 (19%)
TSPAN10NP_001277141.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33
oculospanin_like_LEL 172..291 CDD:239420 23/137 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 327..355
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.