DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eo and tspan13a

DIOPT Version :9

Sequence 1:NP_523641.2 Gene:Tsp42Eo / 35625 FlyBaseID:FBgn0033136 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001002334.1 Gene:tspan13a / 798836 ZFINID:ZDB-GENE-040718-19 Length:203 Species:Danio rerio


Alignment Length:164 Identity:39/164 - (23%)
Similarity:66/164 - (40%) Gaps:34/164 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VCLQWTSVVFSTLTLIVGVLAALAGVYELDK-FNEGSAEHTEKFVQLGMAGALILAGL----VGC 65
            ||.:....:.:.:.::|.:|  |.||....| |...|:        ..:.||:|..||    |..
Zfish     7 VCSKTCLCILNLIYVLVSLL--LIGVAAWGKWFGLVSS--------FSVMGAVIAVGLFLFIVAI 61

  Fly    66 LGAIFGSIK---VMVVNLILLLALIASHIWKVS----HYNETKQLDATEVYVMDLWMKELVHHGA 123
            :| :.|::|   |::...:.:|.|:....:.||    ..|:.:|....|:.    |.|.   ...
Zfish    62 IG-LCGAVKHHQVLLFFYMFILFLVFIVQFSVSCACLAINKEQQNLLLEIG----WNKS---ESM 118

  Fly   124 MQDLQQEYECCGDKGFSDYTSLNMKVPRSCFHTK 157
            ..||::...|| |....||:.   ....:||..|
Zfish   119 QSDLERSLNCC-DFLQVDYSG---SCEATCFKEK 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EoNP_523641.2 Tetraspannin 7..210 CDD:278750 38/163 (23%)
tetraspanin_LEL 110..178 CDD:239401 12/48 (25%)
tspan13aNP_001002334.1 Tetraspannin 8..192 CDD:278750 38/163 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.