DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eo and Tspan33

DIOPT Version :9

Sequence 1:NP_523641.2 Gene:Tsp42Eo / 35625 FlyBaseID:FBgn0033136 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001102697.1 Gene:Tspan33 / 500065 RGDID:1560915 Length:283 Species:Rattus norvegicus


Alignment Length:295 Identity:64/295 - (21%)
Similarity:109/295 - (36%) Gaps:118/295 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PTVRVCLQWTSVVFSTLTLI---VGVLAALAGVYELDKFNEGSAEHTE---KFVQLGMAGALILA 60
            |.|:..|.:.:::|..::::   |||.|.|             .:|.|   ..:.:..|..||:.
  Rat    20 PLVKYLLFFFNMLFWVISMVMVAVGVYARL-------------MKHAEAALACLAVDPAILLIVV 71

  Fly    61 GLV-------GCLGAIFGSIKVM--------VVNLILLLALIASHIW------KVS--------H 96
            |::       ||:|::..:|.::        :|.|:.|.|.|...::      |||        |
  Rat    72 GVLMFLLTFCGCIGSLRENICLLQTFSLCLTIVFLLQLAAGILGFVFSDKARGKVSEIINNAIVH 136

  Fly    97 YNETKQLDATEVYVMDLWMKELVHHGAMQDLQQEYECCGDKGFSDYTSLNM-------------- 147
            |.:            ||.::.|:..|     |:::.|||...:.|: |.||              
  Rat   137 YRD------------DLDLQNLIDFG-----QKKFSCCGGISYRDW-SQNMYFNCSEDNPSRERC 183

  Fly   148 KVPRSC---------FHTK--DGIHAL-------YPYGEGCMAAVKRAYLQIYRYEKWVH----- 189
            .||.||         .:|.  .|:.||       ..|..||          |.:...|:|     
  Rat   184 SVPYSCCLPTPNQAVINTMCGQGMQALDYLEASKVIYTNGC----------IDKLVNWIHSNLFL 238

  Fly   190 -----CGLIGYEVVGIILGITLCCQLTNKTRRYTY 219
                 .||...::|||:|...|..|:.::.:...|
  Rat   239 LGGVALGLAIPQLVGILLSQVLVNQIKDQIKLQLY 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EoNP_523641.2 Tetraspannin 7..210 CDD:278750 60/279 (22%)
tetraspanin_LEL 110..178 CDD:239401 23/99 (23%)
Tspan33NP_001102697.1 penumbra_like_LEL 116..236 CDD:239411 31/147 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.