DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eo and TM4SF

DIOPT Version :9

Sequence 1:NP_523641.2 Gene:Tsp42Eo / 35625 FlyBaseID:FBgn0033136 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001261159.1 Gene:TM4SF / 37786 FlyBaseID:FBgn0020372 Length:292 Species:Drosophila melanogaster


Alignment Length:185 Identity:49/185 - (26%)
Similarity:69/185 - (37%) Gaps:48/185 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 AEHTEKFVQLGMAGALILAGLVGCLGAIF---GSIKVMVVNLILLLALIA--SHIWKVSHYNETK 101
            |.:..|...|||..||    ||.|:...|   |....|..||...:.:..  |.:..:..::.||
  Fly    74 ATNQRKRCLLGMFAAL----LVACICVQFIICGWSLAMRENLPTSVEIFIDDSFVEFLDKFSRTK 134

  Fly   102 QLDATEVYVMDLWMKELVHHGAMQDLQQEYECCGDKGFSDYTSLNMKVPRSCFHTKDGIHALYP- 165
                  |..:.||.:          :|.:.:|||..|..||..|::  |.||....:  ||... 
  Fly   135 ------VDNLHLWNR----------MQSQLQCCGVDGPLDYRRLSL--PWSCCSRPE--HAYESA 179

  Fly   166 ----YGEGCMAAVK---RAYLQIYRYEKWVHCGLIGYEVVGII--LGITLCCQLT 211
                |..||:|.|.   |..|.|..:         |..::.|.  |||.....||
  Fly   180 CDTHYKRGCLAVVSEQIRNRLLITAF---------GAAIIAIFQSLGIFCAVHLT 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EoNP_523641.2 Tetraspannin 7..210 CDD:278750 47/182 (26%)
tetraspanin_LEL 110..178 CDD:239401 21/75 (28%)
TM4SFNP_001261159.1 Tetraspannin 9..224 CDD:278750 47/182 (26%)
uroplakin_I_like_LEL 111..197 CDD:239409 25/105 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.