DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eo and Tsp47F

DIOPT Version :9

Sequence 1:NP_523641.2 Gene:Tsp42Eo / 35625 FlyBaseID:FBgn0033136 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_725044.1 Gene:Tsp47F / 36230 FlyBaseID:FBgn0033629 Length:239 Species:Drosophila melanogaster


Alignment Length:264 Identity:70/264 - (26%)
Similarity:106/264 - (40%) Gaps:80/264 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VRVC----LQWTSVVFSTLTLI--VGVLAA----LAGVYELDKFNEGSAEHTEKFVQLGMAGALI 58
            :|.|    :::....|:.|..|  :|:|.|    ||.|.|.:.|.||..        |.....||
  Fly     1 MRSCGPSLIKYVLFAFNVLFAISGLGILIAGAVVLADVNEFNHFVEGRV--------LAPPIVLI 57

  Fly    59 LAGLV-------GCLGAIFGSIKVMVVNLILLLAL--------IASHIWKVSHYNETKQLDATEV 108
            :.||:       ||.|||..|..:::...:||..:        ||:.::|       |.|:.   
  Fly    58 VTGLIIFLIASLGCFGAIKESPTLLITFAVLLAVIFIVELAVGIAASVFK-------KDLEG--- 112

  Fly   109 YVMDLWMKELVHHGAMQD------LQQEYECCGDKGFSDYTSL--NMKVPRSCFHTK--DGI--H 161
             ::...::|.:.....:|      :||:..|||....:|:.:|  |..:|.||...:  |..  |
  Fly   113 -MVKNSLQESIKRSNSEDTMAWDNIQQKLMCCGVDSPADWRTLSANKTLPGSCCQPQYIDSTVGH 176

  Fly   162 ALYP--------YGEGCMAAVKRAYLQIYRYEKWVHCGLIGYEVVGI------ILGITLCCQLTN 212
            .|..        :..||:..:|.      |.||.... |||   |||      ||||.|.|.|.|
  Fly   177 CLESPALGKDKYFQVGCVGKLKD------RIEKNAII-LIG---VGIGIAFIQILGIVLACYLAN 231

  Fly   213 KTRR 216
            ..|:
  Fly   232 SIRQ 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EoNP_523641.2 Tetraspannin 7..210 CDD:278750 66/253 (26%)
tetraspanin_LEL 110..178 CDD:239401 19/87 (22%)
Tsp47FNP_725044.1 Tetraspannin 9..233 CDD:278750 67/252 (27%)
uroplakin_I_like_LEL 102..205 CDD:239409 26/119 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.