DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eo and Tsp42Ek

DIOPT Version :9

Sequence 1:NP_523641.2 Gene:Tsp42Eo / 35625 FlyBaseID:FBgn0033136 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001246161.1 Gene:Tsp42Ek / 35621 FlyBaseID:FBgn0033133 Length:215 Species:Drosophila melanogaster


Alignment Length:215 Identity:49/215 - (22%)
Similarity:90/215 - (41%) Gaps:34/215 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VVFSTLTLIVGVLAALAGVYELDKFNEGSAEHTEKFVQLGMAGALILAGLVGCLGAIFGSIKVMV 77
            :..:||.|....:|.:..:|                   |:.|.:.::.::||.|....::.:..
  Fly    27 IAIATLALSKAPIAYILFLY-------------------GLGGIIFVSAVLGCCGICMENVCMTA 72

  Fly    78 VNLILLLALIASHIWKVSHYNETKQ----LDATEVYVMDLWMKELVHHGAMQDLQQEYECCGDKG 138
            ....||||.:...:..:..:..|::    ..|.||.:.  |.:|||..|||...|..|||||...
  Fly    73 TYGFLLLAQLIISLLGIFRFKFTEEYIEKFAAEEVQMK--WDEELVEPGAMDIYQTVYECCGRDS 135

  Fly   139 FSDYTSLNMK-VPRSCFHTKDGIHALYPYGEGCMAAVKRAYLQIYRY---EKWVHCGLIGYEVVG 199
            ..||.::..: :|.||:..:|  ..:..|..||:......::.::.|   ..|:   .:|..::.
  Fly   136 PDDYVAIGRQTLPPSCYPQED--PQMPHYLAGCVQKSSENFVVLFSYAHDTNWI---ALGITILM 195

  Fly   200 IILGITLCCQLTNKTRRYTY 219
            :|....|..:...:..||||
  Fly   196 MIAAFYLVGRFRKQRVRYTY 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EoNP_523641.2 Tetraspannin 7..210 CDD:278750 45/204 (22%)
tetraspanin_LEL 110..178 CDD:239401 22/68 (32%)
Tsp42EkNP_001246161.1 Tetraspannin 7..202 CDD:278750 44/200 (22%)
tetraspanin_LEL 94..174 CDD:239401 26/83 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.