DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eo and Tsp42Ei

DIOPT Version :9

Sequence 1:NP_523641.2 Gene:Tsp42Eo / 35625 FlyBaseID:FBgn0033136 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001260756.1 Gene:Tsp42Ei / 35618 FlyBaseID:FBgn0033130 Length:229 Species:Drosophila melanogaster


Alignment Length:239 Identity:61/239 - (25%)
Similarity:105/239 - (43%) Gaps:47/239 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TVRVCLQWTSVVFSTLTLIVGVLAALAGVYELDKFNEGSAEHTEKFVQLG--MAGALILA-GLV- 63
            ||:..|...:.|||    ::|:.....|::    |...:||:.   |.:|  :||.||:| |:| 
  Fly     7 TVKHVLLLLNFVFS----VLGLALIAFGIF----FLISAAENA---VSIGKNVAGGLIIALGVVI 60

  Fly    64 ------GCLGAIF-GSIKVMVVNLILLLALIASHIWKVSHYNETKQLDATEVYVMD----LWMKE 117
                  |||.||. ..:::::....::|.::|..|:.....:.||  |.....:.:    ||..|
  Fly    61 LIIAIFGCLAAIHEAPVRLLIYVGAVVLLILAQLIFLGMSSHGTK--DGISGSINEGFDRLWESE 123

  Fly   118 LVHHGAMQDLQQEYECCGDKGFSDYTSLNMKVPRS------CFHTKDGIHALYPYGEGCMAAVKR 176
            ....||:...:...:|||.....||..::..:|.|      |..|...:     :..||.||..:
  Fly   124 RNQTGALSYYESWLQCCGVNSSEDYWIIHHGIPSSCCPESKCMDTPSRV-----FKTGCKAAFVK 183

  Fly   177 AYLQ----IYRYEKWVHCGLIGYEVVGIILGITLCCQLTNKTRR 216
             ||.    :::...|:   |:..|.||.:.|..|...:.|::||
  Fly   184 -YLDDKLLVFKIVCWL---LVIGEAVGAVFGWLLYSSVKNQSRR 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EoNP_523641.2 Tetraspannin 7..210 CDD:278750 56/227 (25%)
tetraspanin_LEL 110..178 CDD:239401 18/77 (23%)
Tsp42EiNP_001260756.1 Tetraspannin 7..217 CDD:278750 58/231 (25%)
DUF373 <17..>101 CDD:299895 25/94 (27%)
tetraspanin_LEL 104..189 CDD:239401 23/92 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.