DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eo and Tsp42Eg

DIOPT Version :9

Sequence 1:NP_523641.2 Gene:Tsp42Eo / 35625 FlyBaseID:FBgn0033136 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_523633.1 Gene:Tsp42Eg / 35616 FlyBaseID:FBgn0033128 Length:218 Species:Drosophila melanogaster


Alignment Length:233 Identity:58/233 - (24%)
Similarity:97/233 - (41%) Gaps:51/233 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VFSTLTLIVGVLAALAG----------VYELDKFNEGSAEHTEKFVQLGMAGALILAGLVGCLGA 68
            |.....|...::.||.|          :|:.:.||      |..||.:.:...::|..|.|.|||
  Fly     7 VLKGFALFWDIILALFGLVVIGLGVHIIYKFEHFN------TAAFVIIAVGVVVVLTALFGALGA 65

  Fly    69 I---FGSIKVMVVNLILLL---ALIASHIWKVSHYNETKQLDATEVYVMDLWMKELV-----HHG 122
            .   ..:.||.||.||:|:   .|....:|..    :|..|...:.....||..:.|     :..
  Fly    66 ARESSATSKVFVVILIVLVILEVLAVGFLWVF----QTSLLINVDKTFDKLWNDQPVPIKPGNQS 126

  Fly   123 AMQDLQQEYECCGDKGFSDYTSLNMKVPRSCFH-TKDGIHALYPYGEGCMAAVKRAYLQIYRYEK 186
            .:..|::..:|||:.|.|||    :..|.||:: ..|.::.     |||    ::.:|. :..::
  Fly   127 QIASLERWLDCCGNVGPSDY----ILPPNSCYNGESDKLNL-----EGC----RQKFLD-FIADR 177

  Fly   187 W-----VHCGLIGYEVVGIILGITLCCQLTNKTRRYTY 219
            |     |...|:|.|::..:|...|...:.|:.||..|
  Fly   178 WTTFNLVSLVLLGVELICALLAYVLANSIVNRWRRSKY 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EoNP_523641.2 Tetraspannin 7..210 CDD:278750 54/222 (24%)
tetraspanin_LEL 110..178 CDD:239401 18/73 (25%)
Tsp42EgNP_523633.1 Tetraspannin 17..202 CDD:395265 51/208 (25%)
tetraspanin_LEL 95..176 CDD:239401 22/98 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.