DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eo and Tsp42Ef

DIOPT Version :9

Sequence 1:NP_523641.2 Gene:Tsp42Eo / 35625 FlyBaseID:FBgn0033136 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_523632.2 Gene:Tsp42Ef / 35615 FlyBaseID:FBgn0033127 Length:220 Species:Drosophila melanogaster


Alignment Length:226 Identity:54/226 - (23%)
Similarity:83/226 - (36%) Gaps:38/226 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 STLTLIVGVLAALA----------GVYELDKFNEGSAEHTEKFVQLGMAGALILAGLVGCLGAIF 70
            |::.|||..|..|.          |:|....:|.........:..:|:..|.:|..|.|.|.|..
  Fly     5 SSVKLIVYALDVLCTLLALVLISFGIYVAVSYNLNEIGQLTAYGYVGLGAAALLVVLWGYLSAWR 69

  Fly    71 GSIKVMVVNLILLLALIASHI---------WKVSHYNETKQLDATEVYVMDLWMKELVHHGAMQD 126
            .::...|..:|.|..:|.:..         .|....|....|:||       |.:||...|||..
  Fly    70 ENVCCTVTFIIFLCLVIIAQFAVVYLLITQEKTVASNLANALEAT-------WEEELNSPGAMSL 127

  Fly   127 LQQEYECCGDKGFSDYTSLNMKVPRSCFHTKDG------IHALYPYGEGCMAAVKRAYLQIYRYE 185
            .|..::|||.....||.......|.:||...|.      ||.      ||....:..:..:.:..
  Fly   128 YQNWFQCCGRGSPQDYIVNERLPPETCFRNHDKSKPENLIHT------GCRVEFENYWQHLTKIF 186

  Fly   186 KWVHCGLIGYEVVGIILGITLCCQLTNKTRR 216
            ..:...|||:|::..::...||..:.|..||
  Fly   187 NILALVLIGFELLLSVISCRLCNSIRNDARR 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EoNP_523641.2 Tetraspannin 7..210 CDD:278750 51/218 (23%)
tetraspanin_LEL 110..178 CDD:239401 20/73 (27%)
Tsp42EfNP_523632.2 Tetraspannin 7..211 CDD:278750 50/216 (23%)
tetraspanin_LEL 103..181 CDD:239401 24/90 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.