DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eo and Tsp39D

DIOPT Version :9

Sequence 1:NP_523641.2 Gene:Tsp42Eo / 35625 FlyBaseID:FBgn0033136 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_523612.3 Gene:Tsp39D / 35405 FlyBaseID:FBgn0032943 Length:235 Species:Drosophila melanogaster


Alignment Length:252 Identity:51/252 - (20%)
Similarity:96/252 - (38%) Gaps:64/252 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CLQWTSVVFSTLTLIVGVLAAL-AGVYELD--KFNEGSAEH--TEKFVQLGMAGALILAGLVGCL 66
            |:::.:...:.|..:.|:|..| .|:.:|:  .::...::|  |...:.:.:..|:.:...:||.
  Fly     8 CVKYLTFFCNLLFALTGLLIFLVGGMVQLNYAHYSNFVSDHVWTAPIILMIVGAAVAVICFLGCC 72

  Fly    67 GAIFGSIKVMVVNLILLLALI----------------ASHIWKVSHYNETKQLDATEVYVMDLWM 115
            ||:..| ..|:::..||..:|                ..|....|.:|.|.|.........|.|.
  Fly    73 GALKES-SCMILSFALLAVVIFLFEIGLGLAGYVKHTGLHQIMESQFNSTMQHYKERADYRDAWT 136

  Fly   116 KELVHHGAMQDLQQEYECCGDKGFSDYTS--------------LNMKVPRSCFHTKDGIHALYPY 166
            .          ||.|.:|||..|.:|:.:              :|:...:.|.:|    ||..  
  Fly   137 L----------LQTELDCCGINGPNDWETVYRNSTLPAACCSVINLSEAKECTNT----HATQ-- 185

  Fly   167 GEGCMAAVKRAYLQIYRYEKW----VHCGLIGYEVVGIILGITLCCQLTNKTRRYTY 219
             .||:    :..|:|...:..    |..|:.|.:::.|:..   ||...:..|.|.:
  Fly   186 -HGCL----QKLLEILDSKTLILASVVLGVAGIQMLTILFA---CCLYRSFRRSYDH 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EoNP_523641.2 Tetraspannin 7..210 CDD:278750 49/241 (20%)
tetraspanin_LEL 110..178 CDD:239401 17/81 (21%)
Tsp39DNP_523612.3 Tetraspannin 8..227 CDD:278750 49/243 (20%)
tetraspanin_LEL 104..200 CDD:239401 24/116 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.