Sequence 1: | NP_523641.2 | Gene: | Tsp42Eo / 35625 | FlyBaseID: | FBgn0033136 | Length: | 219 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_523552.1 | Gene: | Tsp33B / 34590 | FlyBaseID: | FBgn0032376 | Length: | 326 | Species: | Drosophila melanogaster |
Alignment Length: | 196 | Identity: | 40/196 - (20%) |
---|---|---|---|
Similarity: | 64/196 - (32%) | Gaps: | 82/196 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 57 LILAGLVGCLGAIFGSIKVMVVNLILLLALIASHIWKVSHYNETKQLDATEVYVMDLWMKELVHH 121
Fly 122 GAMQDLQQEYECCGDKGFSDYTSLNMKVPR---------------------SCFH---------- 155
Fly 156 -----------TKDGIHALYPYGEGCMAAVKRAYLQIYRYEKWVHCG--LIGYEVVGIILGITLC 207
Fly 208 C 208 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Tsp42Eo | NP_523641.2 | Tetraspannin | 7..210 | CDD:278750 | 40/196 (20%) |
tetraspanin_LEL | 110..178 | CDD:239401 | 23/109 (21%) | ||
Tsp33B | NP_523552.1 | Tetraspannin | 20..256 | CDD:278750 | 38/194 (20%) |
CD151_like_LEL | 112..237 | CDD:239408 | 29/162 (18%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3882 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |