DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eo and Tsp33B

DIOPT Version :9

Sequence 1:NP_523641.2 Gene:Tsp42Eo / 35625 FlyBaseID:FBgn0033136 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_523552.1 Gene:Tsp33B / 34590 FlyBaseID:FBgn0032376 Length:326 Species:Drosophila melanogaster


Alignment Length:196 Identity:40/196 - (20%)
Similarity:64/196 - (32%) Gaps:82/196 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LILAGLVGCLGAIFGSIKVMVVNLILLLALIASHIWKVSHYNETKQLDATEVYVMDLWMKELVHH 121
            :|:|...||:..::..:.|:.               ..:..:.|:.:|.  .|....|  :|:..
  Fly    99 VIIASGFGCVWNLYRGVDVLE---------------NAADTSLTRGIDM--YYSCPEW--KLLWD 144

  Fly   122 GAMQDLQQEYECCGDKGFSDYTSLNMKVPR---------------------SCFH---------- 155
            |    ||...||||..|:.|:.:... :||                     |||:          
  Fly   145 G----LQWHKECCGVHGYKDWMNAEW-MPRRENNCTSMVLAPFACCKRSCDSCFNNFLPSEGQSI 204

  Fly   156 -----------TKDGIHALYPYGEGCMAAVKRAYLQIYRYEKWVHCG--LIGYEVVGIILGITLC 207
                       |.|.|:|     .||:.|...|.        | :|.  |:...|:.:...|.||
  Fly   205 GGNSRQPFPALTVDSINA-----NGCLPAFVSAV--------W-NCFYILMALWVLALKFLIVLC 255

  Fly   208 C 208
            |
  Fly   256 C 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EoNP_523641.2 Tetraspannin 7..210 CDD:278750 40/196 (20%)
tetraspanin_LEL 110..178 CDD:239401 23/109 (21%)
Tsp33BNP_523552.1 Tetraspannin 20..256 CDD:278750 38/194 (20%)
CD151_like_LEL 112..237 CDD:239408 29/162 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.