DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eo and cd63

DIOPT Version :9

Sequence 1:NP_523641.2 Gene:Tsp42Eo / 35625 FlyBaseID:FBgn0033136 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_955837.1 Gene:cd63 / 321461 ZFINID:ZDB-GENE-030131-180 Length:237 Species:Danio rerio


Alignment Length:254 Identity:58/254 - (22%)
Similarity:105/254 - (41%) Gaps:76/254 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CLQWTSVVFSTLTLIVGVLAALAGVYELDKFNEGSAEHTEKFVQLGMAGA---LILAGLV----- 63
            |:::....|:.:..:.|:...:.|:.      ...:.|....:| |.:|:   ||:.|::     
Zfish     9 CVKYLLFFFNFIFWLCGLALIVLGIL------VHVSLHNTAILQ-GASGSPMVLIVVGVIIFFIS 66

  Fly    64 --GCLGAIFGSIKVMVVNLILLLAL---------IASHIWK--------------VSHYNETKQL 103
              ||.|| :...:.|||...::|:|         ||.:|::              ::.||:|::.
Zfish    67 FFGCCGA-WKENQCMVVTFAIILSLIVITEIGAGIAGYIFRGKVNELLDQSFNTMIAGYNKTEEY 130

  Fly   104 DATEVYVMDLWMKELVHHGAMQDLQQEYECCGDKGFSDYTSL---NMKVPRSCFH--TKD-GIHA 162
            ..|                 :..:|::.:|||....||:.:.   ::.||.||..  ||: ||.|
Zfish   131 RTT-----------------LDSIQKQLKCCGGNSSSDWVNFSADHISVPDSCCKNVTKNCGIGA 178

  Fly   163 LYP----YGEGCMAAVKRAYLQIYRYEKWVHCGLIGYEVVGI--ILGITLCCQLTNKTR 215
            :..    |.|||...::   .:|.....|:..|.:   |:|.  |.||.|.|.|:...|
Zfish   179 MTKPTVIYLEGCQPILE---TRIKENILWIAVGAL---VIGFVQITGIVLACILSRAIR 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EoNP_523641.2 Tetraspannin 7..210 CDD:278750 56/247 (23%)
tetraspanin_LEL 110..178 CDD:239401 19/77 (25%)
cd63NP_955837.1 Tetraspannin 9..230 CDD:278750 57/251 (23%)
CD63_LEL 103..202 CDD:239419 25/118 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.