DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eo and Cd63

DIOPT Version :9

Sequence 1:NP_523641.2 Gene:Tsp42Eo / 35625 FlyBaseID:FBgn0033136 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_008763246.1 Gene:Cd63 / 29186 RGDID:62080 Length:262 Species:Rattus norvegicus


Alignment Length:227 Identity:50/227 - (22%)
Similarity:93/227 - (40%) Gaps:66/227 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VGVLA---ALAGVYELDKFNEGSAEHTEKFVQLGMAGALILAGLVGCLGAIFGSIKVMV-----V 78
            ||::|   |:..|.:....:|.:|......|.:.:...|.|...|||.||...:..:|:     :
  Rat    50 VGLIAIGVAVQVVLKQAITHETTAGSLLPVVIIAVGAFLFLVAFVGCCGACKENYCLMITFAIFL 114

  Fly    79 NLILLLAL---IASHIWK---VSHYNET--KQLDATEVYVMDLWMKELVHHGAMQDLQQEYECCG 135
            :||:|:.:   ||.::::   .|.::::  ||:   :.|:.|.....:     :..||:|.:|||
  Rat   115 SLIMLVEVAVAIAGYVFRDQVKSEFSKSFQKQM---QNYLTDNKTATI-----LDKLQKENKCCG 171

  Fly   136 DKGFSDYTSL----NMKVPRSCF----------HTKDGIHALYPYGEGCMAAVKRAYLQIYRYEK 186
            ...::|:..:    ..:||.||.          ..:..||.     :||:..:          ..
  Rat   172 ASNYTDWERIPGMAKDRVPDSCCINITVGCGNDFKESTIHT-----QGCVETI----------AA 221

  Fly   187 WVH----------CGLIGYEVVGIILGITLCC 208
            |:.          .|:...||:|||..   ||
  Rat   222 WLRKNVLLVAGAALGIAFVEVLGIIFS---CC 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EoNP_523641.2 Tetraspannin 7..210 CDD:278750 50/227 (22%)
tetraspanin_LEL 110..178 CDD:239401 16/81 (20%)
Cd63XP_008763246.1 Tetraspannin 33..255 CDD:278750 50/227 (22%)
ATP-synt_A <72..131 CDD:294288 15/58 (26%)
CD63_LEL 129..227 CDD:239419 21/120 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.