DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eo and tsp-5

DIOPT Version :9

Sequence 1:NP_523641.2 Gene:Tsp42Eo / 35625 FlyBaseID:FBgn0033136 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_502621.3 Gene:tsp-5 / 192061 WormBaseID:WBGene00006631 Length:241 Species:Caenorhabditis elegans


Alignment Length:247 Identity:54/247 - (21%)
Similarity:97/247 - (39%) Gaps:55/247 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VCLQWTSVVFSTLTL---IVGVLAALAGVY-ELDKF----------NEGSAEHTEKF-----VQL 51
            ||.:..:.:|..|.|   :|||:.....:: .|.:|          |..|.::.|.|     :.:
 Worm     5 VCGKLANFLFFILNLGLIVVGVIITWYSIWMVLHQFEVTVARTSLVNLLSVDNIECFYVYRTISI 69

  Fly    52 GMAGALILAGLVGCLGAIFGSIKVMVVNLILLLALIASHIWKVSHY---NETKQLDATEVYVMDL 113
            .:.|.:::.|..||....|||...:.|:|:|:..:....|..:..:   |:..:.:...||    
 Worm    70 MIGGCMVVLGFCGCFAVGFGSKTALSVHLVLVFIVFVVKIVAIVMFLANNDHLRREFVGVY---- 130

  Fly   114 WMKELV--HH------GAMQDLQQEYECCGDKGFSDYTSLNMKVPRSC-FHTKDGIHALYPYGEG 169
             ..|||  :|      ..:..:....:|||..|..|:.... ..|.|| ..||:.:..:    ||
 Worm   131 -RDELVANYHNNSRTKNTLDWVHTSLKCCGANGCEDFLPAG-NFPTSCECGTKNAVVRM----EG 189

  Fly   170 C----MAAVKRAYLQIYRYEKWVHCGLIGYEVVGIILGITLCCQLT-NKTRR 216
            |    .|..:...||:         ..:|...:.|.||:.:...:. ::.||
 Worm   190 CALITWAVFEDGTLQV---------AFLGLICMLIELGLMIFAAIVIDRIRR 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EoNP_523641.2 Tetraspannin 7..210 CDD:278750 51/237 (22%)
tetraspanin_LEL 110..178 CDD:239401 18/80 (23%)
tsp-5NP_502621.3 Tetraspannin 11..223 CDD:278750 50/230 (22%)
tetraspanin_LEL 116..191 CDD:239401 19/84 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.