DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eo and Cd63

DIOPT Version :9

Sequence 1:NP_523641.2 Gene:Tsp42Eo / 35625 FlyBaseID:FBgn0033136 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001036045.1 Gene:Cd63 / 12512 MGIID:99529 Length:238 Species:Mus musculus


Alignment Length:228 Identity:51/228 - (22%)
Similarity:93/228 - (40%) Gaps:55/228 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VGVLA---ALAGVYELDKFNEGSAEHTEKFVQLGMAGALILAGLVGCLGAIFGSIKVMV-----V 78
            ||::|   |:..|.:....:|.:|......|.:.:...|.|...|||.||...:..:|:     :
Mouse    26 VGLIAIGVAVQVVLKQAITHETTAGSLLPVVIIAVGAFLFLVAFVGCCGACKENYCLMITFAIFL 90

  Fly    79 NLILLLAL---IASHIWK---VSHYNETKQLDATEVYVMDLWMKELVHHGAMQDLQQEYECCGDK 137
            :||:|:.:   ||.::::   .|.:|::.|..      |..::|:......:..||:|..|||..
Mouse    91 SLIMLVEVAVAIAGYVFRDQVKSEFNKSFQQQ------MQNYLKDNKTATILDKLQKENNCCGAS 149

  Fly   138 GFSDYTSL----NMKVPRSCF----------HTKDGIHALYPYGEGCMAAVKRAYLQIYRYEKWV 188
            .::|:.::    ..:||.||.          ..:..||.     :||:..:          ..|:
Mouse   150 NYTDWENIPGMAKDRVPDSCCINITVGCGNDFKESTIHT-----QGCVETI----------AIWL 199

  Fly   189 HCG--LIGYEVVGI----ILGITLCCQLTNKTR 215
            ...  |:....:||    :|||...|.|....|
Mouse   200 RKNILLVAAAALGIAFVEVLGIIFSCCLVKSIR 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EoNP_523641.2 Tetraspannin 7..210 CDD:278750 49/221 (22%)
tetraspanin_LEL 110..178 CDD:239401 17/81 (21%)
Cd63NP_001036045.1 Tetraspannin 10..227 CDD:395265 49/221 (22%)
CD63_LEL 105..203 CDD:239419 21/118 (18%)
Lysosomal targeting motif. /evidence=ECO:0000269|PubMed:21041449 234..238
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.