DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42En and CD63

DIOPT Version :9

Sequence 1:NP_001260758.1 Gene:Tsp42En / 35624 FlyBaseID:FBgn0033135 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001244318.1 Gene:CD63 / 967 HGNCID:1692 Length:238 Species:Homo sapiens


Alignment Length:233 Identity:55/233 - (23%)
Similarity:94/233 - (40%) Gaps:63/233 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LKAVLIVLNVLL--------SLIGVTL---IALSVYELNSSTPGTFEHIAIVVQIFVGTFVVLTS 61
            :|.|..:|.|||        .||.|.:   :.||...:..:|||:   :..||.|.||.|:.|.:
Human     7 MKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGS---LLPVVIIAVGVFLFLVA 68

  Fly    62 FLGCFATARVSLGLVWSYVICLLILLCLQIYIIAAAHSTDYVERSK--KDFLATWADQRTNVER- 123
            |:||....:.:..|:.::.|.|.:::.:::    ||....||.|.|  .:|...:..|..|..: 
Human    69 FVGCCGACKENYCLMITFAIFLSLIMLVEV----AAAIAGYVFRDKVMSEFNNNFRQQMENYPKN 129

  Fly   124 ------ISLLEQKYSCCGQLGAHDY------------------ILMGRGIPLSCYKDQERREYSL 164
                  :..::..:.|||.....|:                  :.:|.||..:        |.::
Human   130 NHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFN--------EKAI 186

  Fly   165 FSGGCLQAVQAHATDNVAIGLIIKWLLLLVEFAALGAA 202
            ...||::.:......||          |:|..||||.|
Human   187 HKEGCVEKIGGWLRKNV----------LVVAAAALGIA 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EnNP_001260758.1 Tetraspannin 8..199 CDD:278750 51/228 (22%)
tetraspanin_LEL 96..180 CDD:239401 19/110 (17%)
CD63NP_001244318.1 Tetraspannin 10..227 CDD:395265 54/230 (23%)
CD63_LEL 105..203 CDD:239419 17/105 (16%)
Lysosomal targeting motif. /evidence=ECO:0000250|UniProtKB:P41731 234..238
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.