DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42En and Tsp42Ea

DIOPT Version :9

Sequence 1:NP_001260758.1 Gene:Tsp42En / 35624 FlyBaseID:FBgn0033135 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_525012.2 Gene:Tsp42Ea / 59178 FlyBaseID:FBgn0029508 Length:226 Species:Drosophila melanogaster


Alignment Length:236 Identity:56/236 - (23%)
Similarity:93/236 - (39%) Gaps:28/236 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDCRTSFLKAVLIVLNVLLSLIGVTLIAL------SVYELNSSTPGTFEHIAIVVQIFVGTFVVL 59
            |.|..|.:|.:|.:.|:|.|:.|:.||..      .|..::............|..|.:||.::|
  Fly     1 MSCGISMVKYILFIFNLLCSICGILLIVFGALLFSKVRNMDDFAEALRTQQVPVTMIILGTIILL 65

  Fly    60 TSFLGCFATARVSLGLVWSYVICLLILLCLQIYIIAAAHSTDYVERSKKDFL--------ATWAD 116
            .|:.||....|.|..:..:|.|.|.:|:..|:.::.      |:...|..:|        ..|..
  Fly    66 ISWFGCCGAIRESYCMSMTYSILLFVLMIGQLALVI------YMWVQKDKYLEIMGDVVEKAWNH 124

  Fly   117 QRTNVERISLLEQKYSCCGQLGAHDYILMGRGIPLSCYKDQERREYSLFSGGCLQAVQAHATDNV 181
            :.:..:.:..::....|||:.|..||...|:..|..|......|..:::..||..........|.
  Fly   125 RTSRSDYMDAIQISMKCCGRSGYTDYAYQGKFPPSCCSDTNNCRWETVYRRGCKVTFVEFWDRNS 189

  Fly   182 AI----GLIIKWLLLLVEFAALGAATHLGITVRNKLRRERF 218
            .|    ||:|    ..:||.....|..|..::||..||..:
  Fly   190 DIIKYAGLVI----AAIEFVGFVFACCLANSIRNYRRRAEY 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EnNP_001260758.1 Tetraspannin 8..199 CDD:278750 47/208 (23%)
tetraspanin_LEL 96..180 CDD:239401 16/91 (18%)
Tsp42EaNP_525012.2 Tetraspannin 8..217 CDD:278750 49/218 (22%)
tetraspanin_LEL 104..188 CDD:239401 15/83 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467719
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.