DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42En and Tsp97E

DIOPT Version :9

Sequence 1:NP_001260758.1 Gene:Tsp42En / 35624 FlyBaseID:FBgn0033135 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001263002.1 Gene:Tsp97E / 43241 FlyBaseID:FBgn0039465 Length:228 Species:Drosophila melanogaster


Alignment Length:131 Identity:34/131 - (25%)
Similarity:58/131 - (44%) Gaps:13/131 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KAVLIVLNVLLSLIGVTLIALSVYELNSSTPGTFEHIAIVVQIFV-GTFVVLTSFLGCFATARVS 72
            |..||.||:|..:||..||.:.||...:|   ...::.||..|.. |..::..|.||.....:..
  Fly     9 KNALIALNILYVMIGFLLIGVGVYARAAS---IVTNLPIVGGILACGVILICISMLGLAGAVKHH 70

  Fly    73 LGLVWSYVICLLILLCLQIYIIA---AAHSTDYVERSKKDFLATWADQRTNVERISLLEQKYSCC 134
            ..:::.|:|.|.:|..:|..|.:   |.:|....:.:::.::....|.|..|      :....||
  Fly    71 QVMLFFYMIILFMLFLIQFSIASSCLAVNSEQQQQFAEQGWMTVPTDLRKQV------QDSLKCC 129

  Fly   135 G 135
            |
  Fly   130 G 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EnNP_001260758.1 Tetraspannin 8..199 CDD:278750 34/131 (26%)
tetraspanin_LEL 96..180 CDD:239401 8/40 (20%)
Tsp97ENP_001263002.1 Tetraspannin 7..204 CDD:278750 34/131 (26%)
tetraspanin_LEL <121..177 CDD:243179 4/16 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442873
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.